• Gene id: 53940

Gene Summary

• Gene Symbol: FTHL17   Gene   UCSC   Ensembl
• Aliases: CT38
• Gene name: ferritin heavy chain like 17
• Alternate names: ferritin heavy polypeptide-like 17, cancer/testis antigen 38, epididymis secretory sperm binding protein, ferritin, heavy polypeptide-like 17,
• Gene location: Xp21.2 (31072040: 31071232)     Exons: 1     NC_000023.11
• Gene summary(Entrez): This gene encodes a ferritin heavy chain-like protein. This gene is primarily expressed in embryonic germ cells. The encoded protein may lack ferroxidase activity. Multiple pseudogenes of this gene are found on chromosome X. [provided by RefSeq, Oct 2016]
• OMIM: 612920

Protein Summary

• Protein general information: Q9BXU8  
  • Name: Ferritin heavy polypeptide like 17 (Cancer/testis antigen 38) (CT38)
  • Length: 183  
  • Mass: 21142
  • Tissue specificity: Testis specific. Also expressed in several cancers. {ECO
• Sequence:

  MATAQPSQVRQKYDTNCDAAINSHITLELYTSYLYLSMAFYFNRDDVALENFFRYFLRLSDDKMEHAQKLMRLQN
  LRGGHICLHDIRKPECQGWESGLVAMESAFHLEKNVNQSLLDLYQLAVEKGDPQLCHFLESHYLHEQVKTIKELG
  GYVSNLRKICSPEAGLAEYLFDKLTLGGRVKET

• Structural information:
  • Protein Domains: (11..16-)
    (/note="Ferritin-like-diiron)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00085"-)
  • Interpro: IPR001519  IPR012347  IPR009040  IPR009078  IPR014034   IPR008331  
  • Prosite: PS00204 PS50905
  • STRING: ENSP00000368207
• Other Databases: GeneCards:  FTHL17  Malacards:  FTHL17

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005737	cytoplasm	IBA	cellular component
GO:0006880	intracellular sequestering of iron ion	IBA	biological process
GO:0008198	ferrous iron binding	IBA	molecular function
GO:0004322	ferroxidase activity	IBA	molecular function
GO:0005506	iron ion binding	IBA	molecular function
GO:0008199	ferric iron binding	IBA	molecular function
GO:0006826	iron ion transport	IEA	biological process
GO:0006879	cellular iron ion homeostasis	IEA	biological process
GO:0008199	ferric iron binding	IEA	molecular function
GO:0006879	cellular iron ion homeostasis	IEA	biological process
GO:0046872	metal ion binding	IEA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0055114	oxidation-reduction process	IEA	biological process

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq