• Gene id: 53919

Gene Summary

• Gene Symbol: SLCO1C1   Gene   UCSC   Ensembl
• Aliases: OATP-F, OATP1, OATP14, OATP1C1, OATPF, OATPRP5, SLC21A14
• Gene name: solute carrier organic anion transporter family member 1C1
• Alternate names: solute carrier organic anion transporter family member 1C1, OAT-RP-5, OATP-14, organic anion transporter F, organic anion transporter polypeptide-related protein 5, organic anion transporting polypeptide 14, solute carrier family 21 (organic anion transporter),,
• Gene location: 12p12.2 (20681799: 20753385)     Exons: 20     NC_000012.12
• Gene summary(Entrez): This gene encodes a member of the organic anion transporter family. The encoded protein is a transmembrane receptor that mediates the sodium-independent uptake of thyroid hormones in brain tissues. This protein has particularly high affinity for the thyro
• OMIM: 615347

Protein Summary

• Protein general information: Q9NYB5  
  • Name: Solute carrier organic anion transporter family member 1C1 (Organic anion transporter F) (OATP F) (Organic anion transporter polypeptide related protein 5) (OAT RP 5) (OATPRP5) (Organic anion transporting polypeptide 14) (OATP 14) (Solute carrier family 2
  • Length: 712  
  • Mass: 78696
  • Tissue specificity: Highly expressed in brain and in Leydig cells in testis. Detected in many brain regions with the exception of pons and cerebellum. Not strongly enriched in cerebral microvessels. {ECO
• Sequence:

  MDTSSKENIQLFCKTSVQPVGRPSFKTEYPSSEEKQPCCGELKVFLCALSFVYFAKALAEGYLKSTITQIERRFD
  IPSSLVGVIDGSFEIGNLLVITFVSYFGAKLHRPKIIGAGCVIMGVGTLLIAMPQFFMEQYKYERYSPSSNSTLS
  ISPCLLESSSQLPVSVMEKSKSKISNECEVDTSSSMWIYVFLGNLLRGIGETPIQPLGIAYLDDFASEDNAAFYI
  GCVQTVAIIGPIFGFLLGSLCAKLYVDIGFVNLDHITITPKDPQWVGAWWLGYLIAGIISLLAAVPFWYLPKSLP
  RSQSREDSNSSSEKSKFIIDDHTDYQTPQGENAKIMEMARDFLPSLKNLFGNPVYFLYLCTSTVQFNSLFGMVTY
  KPKYIEQQYGQSSSRANFVIGLINIPAVALGIFSGGIVMKKFRISVCGAAKLYLGSSVFGYLLFLSLFALGCENS
  DVAGLTVSYQGTKPVSYHERALFSDCNSRCKCSETKWEPMCGENGITYVSACLAGCQTSNRSGKNIIFYNCTCVG
  IAASKSGNSSGIVGRCQKDNGCPQMFLYFLVISVITSYTLSLGGIPGYILLLRCIKPQLKSFALGIYTLAIRVLA
  GIPAPVYFGVLIDTSCLKWGFKRCGSRGSCRLYDSNVFRHIYLGLTVILGTVSILLSIAVLFILKKNYVSKHRSF
  ITKRERTMVSTRFQKENYTTSDHLLQPNYWPGKETQL

• Structural information:
  • Protein Domains: (470..52-)
    (/note="Kazal-like-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00798"-)
  • Interpro: IPR002350  IPR036058  IPR020846  IPR036259  IPR004156   IPR030764  
  • Prosite: PS51465 PS50850
  • STRING: ENSP00000444149
• Other Databases: GeneCards:  SLCO1C1  Malacards:  SLCO1C1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0070327	thyroid hormone transport	IDA	biological process
GO:0070327	thyroid hormone transport	IDA	biological process
GO:0005886	plasma membrane	IDA	cellular component
GO:0016323	basolateral plasma membrane	IDA	cellular component
GO:0015349	thyroid hormone transmembrane transporter activity	IDA	molecular function
GO:0015349	thyroid hormone transmembrane transporter activity	IDA	molecular function
GO:0055085	transmembrane transport	IDA	biological process
GO:0055085	transmembrane transport	IDA	biological process
GO:2000611	positive regulation of thyroid hormone generation	IMP	biological process
GO:0150104	transport across blood-brain barrier	NAS	biological process
GO:0150104	transport across blood-brain barrier	NAS	biological process
GO:0015721	bile acid and bile salt transport	IBA	biological process
GO:0015347	sodium-independent organic anion transmembrane transporter activity	IBA	molecular function
GO:0015125	bile acid transmembrane transporter activity	IBA	molecular function
GO:0043252	sodium-independent organic anion transport	IBA	biological process
GO:0005887	integral component of plasma membrane	IBA	cellular component
GO:0008514	organic anion transmembrane transporter activity	IEA	molecular function
GO:0022857	transmembrane transporter activity	IEA	molecular function
GO:0015349	thyroid hormone transmembrane transporter activity	IEA	molecular function
GO:0015711	organic anion transport	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0055085	transmembrane transport	IEA	biological process
GO:0016021	integral component of membrane	IEA	cellular component
GO:0006811	ion transport	IEA	biological process
GO:0005886	plasma membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0043252	sodium-independent organic anion transport	TAS	biological process
GO:0016323	basolateral plasma membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa04919	Thyroid hormone signaling pathway

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq