• Gene id: 53918

Gene Summary

• Gene Symbol: PELO   Gene   UCSC   Ensembl
• Aliases: CGI-17, PRO1770
• Gene name: pelota mRNA surveillance and ribosome rescue factor
• Alternate names: protein pelota homolog, pelota homolog,
• Gene location: 5q11.2 (52787915: 52804043)     Exons: 3     NC_000005.10
• Gene summary(Entrez): This gene encodes a protein which contains a conserved nuclear localization signal. The encoded protein may have a role in spermatogenesis, cell cycle control, and in meiotic cell division. [provided by RefSeq, Jul 2008]
• OMIM: 605757

Protein Summary

• Protein general information: Q9BRX2  
  • Name: Protein pelota homolog (EC 3.1. . )
  • Length: 385  
  • Mass: 43359
  • Tissue specificity: Ubiquitously expressed. {ECO
• Sequence:

  MKLVRKNIEKDNAGQVTLVPEEPEDMWHTYNLVQVGDSLRASTIRKVQTESSTGSVGSNRVRTTLTLCVEAIDFD
  SQACQLRVKGTNIQENEYVKMGAYHTIELEPNRQFTLAKKQWDSVVLERIEQACDPAWSADVAAVVMQEGLAHIC
  LVTPSMTLTRAKVEVNIPRKRKGNCSQHDRALERFYEQVVQAIQRHIHFDVVKCILVASPGFVREQFCDYLFQQA
  VKTDNKLLLENRSKFLQVHASSGHKYSLKEALCDPTVASRLSDTKAAGEVKALDDFYKMLQHEPDRAFYGLKQVE
  KANEAMAIDTLLISDELFRHQDVATRSRYVRLVDSVKENAGTVRIFSSLHVSGEQLSQLTGVAAILRFPVPELSD
  QEGDSSSEED

• Structural information:
  • Interpro: IPR042226  IPR005140  IPR005141  IPR005142  IPR029064   IPR038069  IPR004405  
  • PDB: 1X52 5EO3 5LZW 5LZX 5LZY 5LZZ
  • PDBsum: 1X52 5EO3 5LZW 5LZX 5LZY 5LZZ
  • STRING: ENSP00000274311
• Other Databases: GeneCards:  PELO  Malacards:  PELO

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0070966	nuclear-transcribed mRNA catabolic process, no-go decay	IBA	biological process
GO:0043022	ribosome binding	IBA	molecular function
GO:0070651	nonfunctional rRNA decay	IBA	biological process
GO:0032790	ribosome disassembly	IBA	biological process
GO:0005737	cytoplasm	IBA	cellular component
GO:0070481	nuclear-transcribed mRNA catabolic process, non-stop decay	IEA	biological process
GO:0070966	nuclear-transcribed mRNA catabolic process, no-go decay	IEA	biological process
GO:0071025	RNA surveillance	IEA	biological process
GO:0004518	nuclease activity	IEA	molecular function
GO:0051301	cell division	IEA	biological process
GO:0016787	hydrolase activity	IEA	molecular function
GO:0004519	endonuclease activity	IEA	molecular function
GO:0046872	metal ion binding	IEA	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0007049	cell cycle	IEA	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0051276	chromosome organization	IEA	biological process
GO:0019827	stem cell population maintenance	IEA	biological process
GO:0001833	inner cell mass cell proliferation	IEA	biological process
GO:0060231	mesenchymal to epithelial transition	IEA	biological process
GO:0030513	positive regulation of BMP signaling pathway	IEA	biological process
GO:0007492	endoderm development	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0090305	nucleic acid phosphodiester bond hydrolysis	IEA	biological process
GO:0090305	nucleic acid phosphodiester bond hydrolysis	IEA	biological process

KEGG pathways

Pathway id	Pathway name
hsa03015	mRNA surveillance pathway

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881