• Gene id: 53833

Gene Summary

• Gene Symbol: IL20RB   Gene   UCSC   Ensembl
• Aliases: DIRS1, FNDC6, IL-20R2
• Gene name: interleukin 20 receptor subunit beta
• Alternate names: interleukin-20 receptor subunit beta, IL-20 receptor subunit beta, IL-20R-beta, IL-20RB, fibronectin type III domain containing 6, interleukin 20 receptor beta subunit, interleukin-20 receptor II,
• Gene location: 3q22.3 (136957982: 137011084)     Exons: 9     NC_000003.12
• Gene summary(Entrez): IL20RB and IL20RA (MIM 605620) form a heterodimeric receptor for interleukin-20 (IL20; MIM 605619) (Blumberg et al., 2001 [PubMed 11163236]).[supplied by OMIM, Feb 2009]
• OMIM: 605621

Protein Summary

• Protein general information: Q6UXL0  
  • Name: Interleukin 20 receptor subunit beta (IL 20 receptor subunit beta) (IL 20R beta) (IL 20RB) (Fibronectin type III domain containing 6) (FNDC6) (IL 20R2)
  • Length: 311  
  • Mass: 35076
  • Tissue specificity: Widely expressed with highest levels in skin and testis. Highly expressed in psoriatic skin. {ECO
• Sequence:

  MQTFTMVLEEIWTSLFMWFFYALIPCLLTDEVAILPAPQNLSVLSTNMKHLLMWSPVIAPGETVYYSVEYQGEYE
  SLYTSHIWIPSSWCSLTEGPECDVTDDITATVPYNLRVRATLGSQTSAWSILKHPFNRNSTILTRPGMEITKDGF
  HLVIELEDLGPQFEFLVAYWRREPGAEEHVKMVRSGGIPVHLETMEPGAAYCVKAQTFVKAIGRYSAFSQTECVE
  VQGEAIPLVLALFAFVGFMLILVVVPLFVWKMGRLLQYSCCPVVVLPDTLKITNSPQKLISCRREEVDACATAVM
  SPEELLRAWIS

• Structural information:
  • Protein Domains: (37..13-)
    1 (/note="Fibronectin-type-III)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00316-)
    (144..22-)
    2 (/note="Fibronectin-type-III)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00316"-)
  • Interpro: IPR003961  IPR036116  IPR013783  IPR015373  
  • Prosite: PS50853
  • CDD: cd00063
  • PDB: 4DOH 6DF3
  • PDBsum: 4DOH 6DF3
  • STRING: ENSP00000328133
• Other Databases: GeneCards:  IL20RB  Malacards:  IL20RB

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0019221	cytokine-mediated signaling pathway	IBA	biological process
GO:0016021	integral component of membrane	IBA	cellular component
GO:0005886	plasma membrane	IBA	cellular component
GO:0004896	cytokine receptor activity	IBA	molecular function
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0019221	cytokine-mediated signaling pathway	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0001808	negative regulation of type IV hypersensitivity	IEA	biological process
GO:0002437	inflammatory response to antigenic stimulus	IEA	biological process
GO:0032703	negative regulation of interleukin-2 production	IEA	biological process
GO:0032733	positive regulation of interleukin-10 production	IEA	biological process
GO:0032753	positive regulation of interleukin-4 production	IEA	biological process
GO:0042015	interleukin-20 binding	IEA	molecular function
GO:0042130	negative regulation of T cell proliferation	IEA	biological process
GO:0048873	homeostasis of number of cells within a tissue	IEA	biological process
GO:0050863	regulation of T cell activation	IEA	biological process
GO:0002765	immune response-inhibiting signal transduction	IEA	biological process
GO:0032689	negative regulation of interferon-gamma production	IEA	biological process
GO:0016020	membrane	IEA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa04060	Cytokine-cytokine receptor interaction
hsa04630	JAK-STAT signaling pathway
hsa04061	Viral protein interaction with cytokine and cytokine receptor

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)