• Gene id: 53822

Gene Summary

• Gene Symbol: FXYD7   Gene   UCSC   Ensembl
• Gene name: FXYD domain containing ion transport regulator 7
• Alternate names: FXYD domain-containing ion transport regulator 7,
• Gene location: 19q13.12 (35143254: 35154301)     Exons: 6     NC_000019.10
• Gene summary(Entrez): This reference sequence was derived from multiple replicate ESTs and validated by similar human genomic sequence. This gene encodes a member of a family of small membrane proteins that share a 35-amino acid signature sequence domain, beginning with the se
• OMIM: 600915

Protein Summary

• Protein general information: P58549  
  • Name: FXYD domain containing ion transport regulator 7
  • Length: 80  
  • Mass: 8524
• Sequence:

  MATPTQTPTKAPEEPDPFYYDYNTVQTVGMTLATILFLLGILIVISKKVKCRKADSRSESPTCKSCKSELPSSAP
  GGGGV

• Structural information:
  • Interpro: IPR000272  
  • Prosite: PS01310
  • STRING: ENSP00000270310
• Other Databases: GeneCards:  FXYD7  Malacards:  FXYD7

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:2000649	regulation of sodium ion transmembrane transporter activity	IBA	biological process
GO:0017080	sodium channel regulator activity	IBA	molecular function
GO:0043269	regulation of ion transport	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0099106	ion channel regulator activity	IEA	molecular function
GO:0006811	ion transport	IEA	biological process
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0034220	ion transmembrane transport	TAS	biological process
GO:1903779	regulation of cardiac conduction	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0051117	ATPase binding	IEA	molecular function
GO:0043269	regulation of ion transport	IEA	biological process
GO:0016020	membrane	IEA	cellular component

Diseases

Associated diseases	References
Spermatogenic defects	MIK: 31037746

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
31037746	Spermatogenic defects			16 (1 control, 15 cases)	Male infertility	GSE6023 analyzed using GEO2R