• Gene id: 53820

Gene Summary

• Gene Symbol: RIPPLY3   Gene   UCSC   Ensembl
• Aliases: DSCR6
• Gene name: ripply transcriptional repressor 3
• Alternate names: protein ripply3, Down syndrome critical region gene 6, down syndrome critical region protein 6, ripply3 homolog,
• Gene location: 21q22.13 (37006149: 37019661)     Exons: 5     NC_000021.9
• OMIM: 600896

Protein Summary

• Protein general information: P57055  
  • Name: Protein ripply3 (Down syndrome critical region protein 6)
  • Length: 190  
  • Mass: 20368
  • Tissue specificity: Expressed at a low level in fetal kidney and fetal brain. {ECO
• Sequence:

  MEPEAAAGARKARGRGCHCPGDAPWRPPPPRGPESPAPWRPWIQTPGDAELTRTGRPLEPRADQHTFGSKGAFGF
  QHPVRVYLPMSKRQEYLRSSGEQVLASFPVQATIDFYDDESTESASEAEEPEEGPPPLHLLPQEVGGRQENGPGG
  KGRDQGINQGQRSSGGGDHWGEGPLPQGVSSRGGKCSSSK

• Structural information:
  • Interpro: IPR028127  
  • STRING: ENSP00000331734
• Other Databases: GeneCards:  RIPPLY3  Malacards:  RIPPLY3

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0000122	negative regulation of transcription by RNA polymerase II	IBA	biological process
GO:0005634	nucleus	IBA	cellular component
GO:0009880	embryonic pattern specification	IBA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0007275	multicellular organism development	IEA	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0008285	negative regulation of cell population proliferation	IEA	biological process
GO:0060037	pharyngeal system development	IEA	biological process
GO:0007507	heart development	IEA	biological process
GO:0000122	negative regulation of transcription by RNA polymerase II	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0008150	biological_process	ND	biological process
GO:0005634	nucleus	NAS	cellular component
GO:0000122	negative regulation of transcription by RNA polymerase II	IBA	biological process
GO:0005634	nucleus	IBA	cellular component
GO:0009880	embryonic pattern specification	IBA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0007275	multicellular organism development	IEA	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0008285	negative regulation of cell population proliferation	IEA	biological process
GO:0060037	pharyngeal system development	IEA	biological process
GO:0007507	heart development	IEA	biological process
GO:0000122	negative regulation of transcription by RNA polymerase II	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0008150	biological_process	ND	biological process
GO:0005634	nucleus	NAS	cellular component

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881