• Gene id: 5367

Gene Summary

• Gene Symbol: PMCH   Gene   UCSC   Ensembl
• Aliases: MCH, ppMCH
• Gene name: pro-melanin concentrating hormone
• Alternate names: pro-MCH, prepro-MCH, prepro-melanin-concentrating hormone,
• Gene location: 12q23.2 (102199539: 102196458)     Exons: 3     NC_000012.12
• Gene summary(Entrez): This gene encodes a preproprotein that is proteolytically processed to generate multiple protein products. These products include melanin-concentrating hormone (MCH), neuropeptide-glutamic acid-isoleucine (NEI), and neuropeptide-glycine-glutamic acid (NGE
• OMIM: 176795

Protein Summary

• Protein general information: P20382  
  • Name: Pro MCH [Cleaved into: Neuropeptide glycine glutamic acid (NGE) (Neuropeptide G E); Neuropeptide glutamic acid isoleucine (NEI) (Neuropeptide E I); Melanin concentrating hormone (MCH)]
  • Length: 165  
  • Mass: 18679
  • Tissue specificity: Predominantly expressed in lateral hypothalamus, also detected in pallidum, neocortex and cerebellum. Also found in thymus, brown adipose tissue, duodenum and testis (spermatogonia, early spermatocytes and Sertoli cells). No expression
• Sequence:

  MAKMNLSSYILILTFSLFSQGILLSASKSIRNLDDDMVFNTFRLGKGFQKEDTAEKSVIAPSLEQYKNDESSFMN
  EEENKVSKNTGSKHNFLNHGLPLNLAIKPYLALKGSVAFPAENGVQNTESTQEKREIGDEENSAKFPIGRRDFDM
  LRCMLGRVYRPCWQV

• Structural information:
  • Interpro: IPR005456  
  • STRING: ENSP00000332225
• Other Databases: GeneCards:  PMCH  Malacards:  PMCH

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0031777	type 1 melanin-concentrating hormone receptor binding	IBA	molecular function
GO:0007268	chemical synaptic transmission	IEA	biological process
GO:0030354	melanin-concentrating hormone activity	IEA	molecular function
GO:0030154	cell differentiation	IEA	biological process
GO:0005576	extracellular region	IEA	cellular component
GO:0007218	neuropeptide signaling pathway	IEA	biological process
GO:0007283	spermatogenesis	IEA	biological process
GO:0007275	multicellular organism development	IEA	biological process
GO:0005179	hormone activity	IEA	molecular function
GO:0007186	G protein-coupled receptor signaling pathway	TAS	biological process
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0007631	feeding behavior	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0005576	extracellular region	IEA	cellular component
GO:0045202	synapse	IEA	cellular component
GO:0007631	feeding behavior	ISS	biological process
GO:0005576	extracellular region	NAS	cellular component

KEGG pathways

Pathway id	Pathway name
hsa04080	Neuroactive ligand-receptor interaction

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)