• Gene id: 5365

Gene Summary

• Gene Symbol: PLXNB3   Gene   UCSC   Ensembl
• Aliases: PLEXB3, PLEXR, PLXN6
• Gene name: plexin B3
• Alternate names: plexin-B3, plexin 6,
• Gene location: Xq28 (153764195: 153779345)     Exons: 37     NC_000023.11
• Gene summary(Entrez): The protein encoded by this gene is a member of the plexin family. It functions as a receptor for semaphorin 5A, and plays a role in axon guidance, invasive growth and cell migration. Alternatively spliced transcript variants encoding different isoforms h
• OMIM: 604626

Protein Summary

• Protein general information: Q9ULL4  
  • Name: Plexin B3
  • Length: 1909  
  • Mass: 206847
  • Tissue specificity: Expression detected in Purkinje and granular cells in cerebellum, and in brain neocortex but not in corpus callosum. Expressed in glioma cells and embryonic kidney cells (at protein level). Expressed in brain, liver, pancreas and place
• Sequence:

  MCHAAQETPLLHHFMAPVMARWPPFGLCLLLLLLSPPPLPLTGAHRFSAPNTTLNHLALAPGRGTLYVGAVNRLF
  QLSPELQLEAVAVTGPVIDSPDCVPFRDPAECPQAQLTDNANQLLLVSSRAQELVACGQVRQGVCETRRLGDVAE
  VLYQAEDPGDGQFVAANTPGVATVGLVVPLPGRDLLLVARGLAGKLSAGVPPLAIRQLAGSQPFSSEGLGRLVVG
  DFSDYNNSYVGAFADARSAYFVFRRRGARAQAEYRSYVARVCLGDTNLYSYVEVPLACQGQGLIQAAFLAPGTLL
  GVFAAGPRGTQAALCAFPMVELGASMEQARRLCYTAGGRGPSGAEEATVEYGVTSRCVTLPLDSPESYPCGDEHT
  PSPIAGRQPLEVQPLLKLGQPVSAVAALQADGHMIAFLGDTQGQLYKVFLHGSQGQVYHSQQVGPPGSAISPDLL
  LDSSGSHLYVLTAHQVDRIPVAACPQFPDCASCLQAQDPLCGWCVLQGRCTRKGQCGRAGQLNQWLWSYEEDSHC
  LHIQSLLPGHHPRQEQGQVTLSVPRLPILDADEYFHCAFGDYDSLAHVEGPHVACVTPPQDQVPLNPPGTDHVTV
  PLALMFEDVTVAATNFSFYDCSAVQALEAAAPCRACVGSIWRCHWCPQSSHCVYGEHCPEGERTIYSAQEVDIQV
  RGPGACPQVEGLAGPHLVPVGWESHLALRVRNLQHFRGLPASFHCWLELPGELRGLPATLEETAGDSGLIHCQAH
  QFYPSMSQRELPVPIYVTQGEAQRLDNTHALYVILYDCAMGHPDCSHCQAANRSLGCLWCADGQPACRYGPLCPP
  GAVELLCPAPSIDAVEPLTGPPEGGLALTILGSNLGRAFADVQYAVSVASRPCNPEPSLYRTSARIVCVTSPAPN
  GTTGPVRVAIKSQPPGISSQHFTYQDPVLLSLSPRWGPQAGGTQLTIRGQHLQTGGNTSAFVGGQPCPILEPVCP
  EAIVCRTRPQAAPGEAAVLVVFGHAQRTLLASPFRYTANPQLVAAEPSASFRGGGRLIRVRGTGLDVVQRPLLSV
  WLEADAEVQASRAQPQDPQPRRSCGAPAADPQACIQLGGGLLQCSTVCSVNSSSLLLCRSPAVPDRAHPQRVFFT
  LDNVQVDFASASGGQGFLYQPNPRLAPLSREGPARPYRLKPGHVLDVEGEGLNLGISKEEVRVHIGRGECLVKTL
  TRTHLYCEPPAHAPQPANGSGLPQFVVQMGNVQLALGPVQYEAEPPLSAFPVEAQAGVGMGAAVLIAAVLLLTLM
  YRHKSKQALRDYQKVLVQLESLETGVGDQCRKEFTDLMTEMTDLSSDLEGSGIPFLDYRTYAERAFFPGHGGCPL
  QPKPEGPGEDGHCATVRQGLTQLSNLLNSKLFLLTLIHTLEEQPSFSQRDRCHVASLLSLALHGKLEYLTDIMRT
  LLGDLAAHYVHRNPKLMLRRTETMVEKLLTNWLSICLYAFLREVAGEPLYMLFRAIQYQVDKGPVDAVTGKAKRT
  LNDSRLLREDVEFQPLTLMVLVGPGAGGAAGSSEMQRVPARVLDTDTITQVKEKVLDQVYKGTPFSQRPSVHALD
  LEWRSGLAGHLTLSDEDLTSVTQNHWKRLNTLQHYKVPDGATVGLVPQLHRGSTISQSLAQRCPLGENIPTLEDG
  EEGGVCLWHLVKATEEPEGAKVRCSSLREREPARAKAIPEIYLTRLLSMKGTLQKFVDDTFQAILSVNRPIPIAV
  KYLFDLLDELAEKHGIEDPGTLHIWKTNSLLLRFWVNALKNPQLIFDVRVSDNVDAILAVIAQTFIDSCTTSEHK
  VGRDSPVNKLLYAREIPRYKQMVERYYADIRQSSPASYQEMNSALAELSGNYTSAPHCLEALQELYNHIHRYYDQ
  IISALEEDPVGQKLQLACRLQQVAALVENKVTDL

• Structural information:
  • Protein Domains: (45..47-)
    (/note="Sema-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00352-)
    (473..52-)
    (/note="PSI-1)
    (620..68-)
    (/note="PSI-2)
    (787..83-)
    (/note="PSI-3)
    (835..92-)
    (/note="IPT/TIG-1)
    (927..101-)
    (/note="IPT/TIG-2";)
  • Interpro: IPR013783  IPR014756  IPR002909  IPR031148  IPR013548   IPR002165  IPR016201  IPR008936  IPR001627  IPR036352  IPR041019  IPR041362  IPR015943  
  • Prosite: PS51004
  • STRING: ENSP00000442736
• Other Databases: GeneCards:  PLXNB3  Malacards:  PLXNB3

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0060326	cell chemotaxis	IDA	biological process
GO:0017154	semaphorin receptor activity	IDA	molecular function
GO:0007162	negative regulation of cell adhesion	IDA	biological process
GO:0071526	semaphorin-plexin signaling pathway	IDA	biological process
GO:0050918	positive chemotaxis	IDA	biological process
GO:0019904	protein domain specific binding	IPI	molecular function
GO:0010593	negative regulation of lamellipodium assembly	ISS	biological process
GO:0034260	negative regulation of GTPase activity	IMP	biological process
GO:0030336	negative regulation of cell migration	IMP	biological process
GO:0001938	positive regulation of endothelial cell proliferation	IMP	biological process
GO:0007156	homophilic cell adhesion via plasma membrane adhesion molecules	IDA	biological process
GO:0098632	cell-cell adhesion mediator activity	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0009986	cell surface	IDA	cellular component
GO:0010976	positive regulation of neuron projection development	IDA	biological process
GO:0007165	signal transduction	IEA	biological process
GO:0017154	semaphorin receptor activity	IEA	molecular function
GO:0071526	semaphorin-plexin signaling pathway	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0007399	nervous system development	IEA	biological process
GO:0005886	plasma membrane	IEA	cellular component
GO:0050772	positive regulation of axonogenesis	IBA	biological process
GO:0030336	negative regulation of cell migration	IBA	biological process
GO:0030334	regulation of cell migration	IBA	biological process
GO:0008360	regulation of cell shape	IBA	biological process
GO:1902287	semaphorin-plexin signaling pathway involved in axon guidance	IBA	biological process
GO:0043087	regulation of GTPase activity	IBA	biological process
GO:0017154	semaphorin receptor activity	IBA	molecular function
GO:0007162	negative regulation of cell adhesion	IBA	biological process
GO:0005887	integral component of plasma membrane	IBA	cellular component
GO:0002116	semaphorin receptor complex	IBA	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0071526	semaphorin-plexin signaling pathway	IEA	biological process
GO:0010593	negative regulation of lamellipodium assembly	IEA	biological process
GO:0051022	Rho GDP-dissociation inhibitor binding	IEA	molecular function
GO:0030336	negative regulation of cell migration	IEA	biological process
GO:0005886	plasma membrane	IEA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa04360	Axon guidance

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq