• Gene id: 53637

Gene Summary

• Gene Symbol: S1PR5   Gene   UCSC   Ensembl
• Aliases: EDG8, Edg-8, S1P5, SPPR-1, SPPR-2
• Gene name: sphingosine-1-phosphate receptor 5
• Alternate names: sphingosine 1-phosphate receptor 5, S1P receptor 5, S1P receptor Edg-8, endothelial differentiation G-protein-coupled receptor 8, endothelial differentiation, sphingolipid G-protein-coupled receptor, 8, sphingosine 1-phosphate receptor EDG8, sphingosine 1-phosp,
• Gene location: 19p13.2 (10517964: 10512741)     Exons: 3     NC_000019.10
• Gene summary(Entrez): The lysosphingolipid sphingosine 1-phosphate (S1P) regulates cell proliferation, apoptosis, motility, and neurite retraction. Its actions may be both intracellular as a second messenger and extracellular as a receptor ligand. S1P and the structurally rela
• OMIM: 601565

Protein Summary

• Protein general information: Q9H228  
  • Name: Sphingosine 1 phosphate receptor 5 (S1P receptor 5) (S1P5) (Endothelial differentiation G protein coupled receptor 8) (Sphingosine 1 phosphate receptor Edg 8) (S1P receptor Edg 8)
  • Length: 398  
  • Mass: 41775
  • Tissue specificity: Widely expressed in the brain, most prominently in the corpus callosum, which is predominantly white matter. Detected in spleen, peripheral blood leukocytes, placenta, lung, aorta and fetal spleen. Low-level signal detected in many tis
• Sequence:

  MESGLLRPAPVSEVIVLHYNYTGKLRGARYQPGAGLRADAVVCLAVCAFIVLENLAVLLVLGRHPRFHAPMFLLL
  GSLTLSDLLAGAAYAANILLSGPLTLKLSPALWFAREGGVFVALTASVLSLLAIALERSLTMARRGPAPVSSRGR
  TLAMAAAAWGVSLLLGLLPALGWNCLGRLDACSTVLPLYAKAYVLFCVLAFVGILAAICALYARIYCQVRANARR
  LPARPGTAGTTSTRARRKPRSLALLRTLSVVLLAFVACWGPLFLLLLLDVACPARTCPVLLQADPFLGLAMANSL
  LNPIIYTLTNRDLRHALLRLVCCGRHSCGRDPSGSQQSASAAEASGGLRRCLPPGLDGSFSGSERSSPQRDGLDT
  SGSTGSPGAPTAARTLVSEPAAD

• Structural information:
  • Interpro: IPR005386  IPR000276  IPR017452  IPR004061  
  • Prosite: PS00237 PS50262
  • STRING: ENSP00000328472
• Other Databases: GeneCards:  S1PR5  Malacards:  S1PR5

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0007189	adenylate cyclase-activating G protein-coupled receptor signaling pathway	IBA	biological process
GO:0019222	regulation of metabolic process	IBA	biological process
GO:0004930	G protein-coupled receptor activity	IBA	molecular function
GO:0005737	cytoplasm	IBA	cellular component
GO:0005886	plasma membrane	IBA	cellular component
GO:0038036	sphingosine-1-phosphate receptor activity	IEA	molecular function
GO:0004930	G protein-coupled receptor activity	IEA	molecular function
GO:0007186	G protein-coupled receptor signaling pathway	IEA	biological process
GO:0016021	integral component of membrane	IEA	cellular component
GO:0007165	signal transduction	IEA	biological process
GO:0007186	G protein-coupled receptor signaling pathway	IEA	biological process
GO:0004930	G protein-coupled receptor activity	IEA	molecular function
GO:0005886	plasma membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0007186	G protein-coupled receptor signaling pathway	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0045664	regulation of neuron differentiation	IEA	biological process
GO:0016021	integral component of membrane	IEA	cellular component
GO:0004930	G protein-coupled receptor activity	IEA	molecular function
GO:0005886	plasma membrane	IEA	cellular component
GO:0003376	sphingosine-1-phosphate receptor signaling pathway	IEA	biological process

KEGG pathways

Pathway id	Pathway name
hsa04080	Neuroactive ligand-receptor interaction
hsa04071	Sphingolipid signaling pathway

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881