• Gene id: 53635

Gene Summary

• Gene Symbol: PTOV1   Gene   UCSC   Ensembl
• Aliases: ACID2, PTOV-1
• Gene name: PTOV1 extended AT-hook containing adaptor protein
• Alternate names: prostate tumor-overexpressed gene 1 protein, activator interaction domain-containing protein 2, prostate tumor overexpressed 1,
• Gene location: 19q13.33 (14974857: 14145048)     Exons: 32     NC_000007.14
• Gene summary(Entrez): This gene encodes a protein that was found to be overexpressed in prostate adenocarcinomas. The encoded protein was found to interact with the lipid raft protein flotillin-1 and shuttle it from the cytoplasm to the nucleus in a cell cycle dependent manner
• OMIM: 610195

Protein Summary

• Protein general information: Q86YD1  
  • Name: Prostate tumor overexpressed gene 1 protein (PTOV 1) (Activator interaction domain containing protein 2)
  • Length: 416  
  • Mass: 46869
  • Tissue specificity: Expressed in brain, heart, kidney, liver, placenta, skeletal muscle and small intestine. {ECO
• Sequence:

  MVRPRRAPYRSGAGGPLGGRGRPPRPLVVRAVRSRSWPASPRGPQPPRIRARSAPPMEGARVFGALGPIGPSSPG
  LTLGGLAVSEHRLSNKLLAWSGVLEWQEKRRPYSDSTAKLKRTLPCQAYVNQGENLETDQWPQKLIMQLIPQQLL
  TTLGPLFRNSQLAQFHFTNRDCDSLKGLCRIMGNGFAGCMLFPHISPCEVRVLMLLYSSKKKIFMGLIPYDQSGF
  VSAIRQVITTRKQAVGPGGVNSGPVQIVNNKFLAWSGVMEWQEPRPEPNSRSKRWLPSHVYVNQGEILRTEQWPR
  KLYMQLIPQQLLTTLVPLFRNSRLVQFHFTKDLETLKSLCRIMDNGFAGCVHFSYKASCEIRVLMLLYSSEKKIF
  IGLIPHDQGNFVNGIRRVIANQQQVLQRNLEQEQQQRGMGG

• Structural information:
  • Interpro: IPR021394  IPR038196  
  • STRING: ENSP00000375717
• Other Databases: GeneCards:  PTOV1  Malacards:  PTOV1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0045944	positive regulation of transcription by RNA polymerase II	IBA	biological process
GO:0005667	transcription regulator complex	IBA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0048471	perinuclear region of cytoplasm	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq