• Gene id: 53616

Gene Summary

• Gene Symbol: ADAM22   Gene   UCSC   Ensembl
• Aliases: ADAM 22, EIEE61, MDC2
• Gene name: ADAM metallopeptidase domain 22
• Alternate names: disintegrin and metalloproteinase domain-containing protein 22, a disintegrin and metalloproteinase domain 22, metalloproteinase-disintegrin ADAM22-3, metalloproteinase-like, disintegrin-like, and cysteine-rich protein 2,
• Gene location: 7q21.12 (87934142: 88202888)     Exons: 35     NC_000007.14
• Gene summary(Entrez): This gene encodes a member of the ADAM (a disintegrin and metalloprotease domain) family. Members of this family are membrane-anchored proteins structurally related to snake venom disintegrins, and have been implicated in a variety of biological processes
• OMIM: 603709

Protein Summary

• Protein general information: Q9P0K1  
  • Name: Disintegrin and metalloproteinase domain containing protein 22 (ADAM 22) (Metalloproteinase disintegrin ADAM22 3) (Metalloproteinase like, disintegrin like, and cysteine rich protein 2)
  • Length: 906  
  • Mass: 100433
  • Tissue specificity: Highly expressed in the brain and in some high-grade but not low-grade gliomas. Detected slightly or not at all in other tissues. {ECO
• Sequence:

  MQAAVAVSVPFLLLCVLGTCPPARCGQAGDASLMELEKRKENRFVERQSIVPLRLIYRSGGEDESRHDALDTRVR
  GDLGGPQLTHVDQASFQVDAFGTSFILDVVLNHDLLSSEYIERHIEHGGKTVEVKGGEHCYYQGHIRGNPDSFVA
  LSTCHGLHGMFYDGNHTYLIEPEENDTTQEDFHFHSVYKSRLFEFSLDDLPSEFQQVNITPSKFILKPRPKRSKR
  QLRRYPRNVEEETKYIELMIVNDHLMFKKHRLSVVHTNTYAKSVVNMADLIYKDQLKTRIVLVAMETWATDNKFA
  ISENPLITLREFMKYRRDFIKEKSDAVHLFSGSQFESSRSGAAYIGGICSLLKGGGVNEFGKTDLMAVTLAQSLA
  HNIGIISDKRKLASGECKCEDTWSGCIMGDTGYYLPKKFTQCNIEEYHDFLNSGGGACLFNKPSKLLDPPECGNG
  FIETGEECDCGTPAECVLEGAECCKKCTLTQDSQCSDGLCCKKCKFQPMGTVCREAVNDCDIRETCSGNSSQCAP
  NIHKMDGYSCDGVQGICFGGRCKTRDRQCKYIWGQKVTASDKYCYEKLNIEGTEKGNCGKDKDTWIQCNKRDVLC
  GYLLCTNIGNIPRLGELDGEITSTLVVQQGRTLNCSGGHVKLEEDVDLGYVEDGTPCGPQMMCLEHRCLPVASFN
  FSTCLSSKEGTICSGNGVCSNELKCVCNRHWIGSDCNTYFPHNDDAKTGITLSGNGVAGTNIIIGIIAGTILVLA
  LILGITAWGYKNYREQRQLPQGDYVKKPGDGDSFYSDIPPGVSTNSASSSKKRSNGLSHSWSERIPDTKHISDIC
  ENGRPRSNSWQGNLGGNKKKIRGKRFRPRSNSTETLSPAKSPSSSTGSIASSRKYPYPMPPLPDEDKKVNRQSAR
  LWETSI

• Structural information:
  • Protein Domains: (239..43-)
    (/note="Peptidase-M12B)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00276-)
    (444..53-)
    (/note="Disintegrin-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00068-)
    (675..71-)
    (/note="EGF-like"-)
  • Interpro: IPR006586  IPR018358  IPR001762  IPR036436  IPR013032   IPR013111  IPR024079  IPR001590  IPR002870  IPR034027  
  • Prosite: PS50215 PS00427 PS50214 PS00022
  • CDD: cd04269
  • PDB: 3G5C 5Y2Z 5Y31
  • PDBsum: 3G5C 5Y2Z 5Y31
  • STRING: ENSP00000265727
• Other Databases: GeneCards:  ADAM22  Malacards:  ADAM22

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005886	plasma membrane	IDA	cellular component
GO:0030424	axon	ISS	cellular component
GO:0016021	integral component of membrane	ISS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0006508	proteolysis	IEA	biological process
GO:0004222	metalloendopeptidase activity	IEA	molecular function
GO:0008237	metallopeptidase activity	IEA	molecular function
GO:0042995	cell projection	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0007155	cell adhesion	IEA	biological process
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0007417	central nervous system development	TAS	biological process
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0099061	integral component of postsynaptic density membrane	IEA	cellular component
GO:0042063	gliogenesis	IEA	biological process
GO:0022011	myelination in peripheral nervous system	IEA	biological process
GO:0016021	integral component of membrane	IEA	cellular component
GO:0014037	Schwann cell differentiation	IEA	biological process
GO:0099645	neurotransmitter receptor localization to postsynaptic specialization membrane	IEA	biological process
GO:0098978	glutamatergic synapse	IEA	cellular component
GO:0030424	axon	IEA	cellular component
GO:0008344	adult locomotory behavior	IEA	biological process
GO:0030424	axon	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0007162	negative regulation of cell adhesion	NAS	biological process
GO:0016021	integral component of membrane	NAS	cellular component
GO:0005178	integrin binding	NAS	molecular function

Diseases

Associated diseases	References
Early infantile epileptic encephalopathy	KEGG:H00606
Early infantile epileptic encephalopathy	KEGG:H00606
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)