Home
Search

Simple

Advanced

Syndromes

Chromosomal defects

Infertility phenotypes

Highthroughput dataset
Browse

Genes

Proteins

SNPs

References

GO

Diseases

Pathways

Tools

Orthologs

SNPs

Motif scan

STRING

CDART
BLAST

BLASTN

BLASTP
Analysis

Panther

Function

GO

Pathways

Diseases
  Help
Statistics
   About Us

Search Result


Gene id 5359
Gene Summary    Protein Summary    Gene ontology    Diseases    PubMed    

Gene Summary
Gene Symbol PLSCR1   Gene   UCSC   Ensembl
Aliases MMTRA1B
Gene name phospholipid scramblase 1
Alternate names phospholipid scramblase 1, PL scramblase 1, ca(2+)-dependent phospholipid scramblase 1, erythrocyte phospholipid scramblase,
Gene location 3q24 (146544804: 146515177)     Exons: 11     NC_000003.12
OMIM 604170

Protein Summary
Protein general information O15162  

Name: Phospholipid scramblase 1 (PL scramblase 1) (Ca(2+) dependent phospholipid scramblase 1) (Erythrocyte phospholipid scramblase) (MmTRA1b)

Length: 318  Mass: 35049

Tissue specificity: Expressed in platelets, erythrocyte membranes, lymphocytes, spleen, thymus, prostate, testis, uterus, intestine, colon, heart, placenta, lung, liver, kidney and pancreas. Not detected in brain and skeletal muscle.

Sequence MDKQNSQMNASHPETNLPVGYPPQYPPTAFQGPPGYSGYPGPQVSYPPPPAGHSGPGPAGFPVPNQPVYNQPVYN
QPVGAAGVPWMPAPQPPLNCPPGLEYLSQIDQILIHQQIELLEVLTGFETNNKYEIKNSFGQRVYFAAEDTDCCT
RNCCGPSRPFTLRIIDNMGQEVITLERPLRCSSCCCPCCLQEIEIQAPPGVPIGYVIQTWHPCLPKFTIQNEKRE
DVLKISGPCVVCSCCGDVDFEIKSLDEQCVVGKISKHWTGILREAFTDADNFGIQFPLDLDVKMKAVMIGACFLI
DFMFFESTGSQEQKSGVW
Structural information
Interpro:  IPR005552  

PDB:  		 1Y2A
PDBsum:   1Y2A
MINT:  
STRING:   ENSP00000345494
Other Databases GeneCards:  PLSCR1  Malacards:  PLSCR1

Gene ontology

Expand All | Collapse All
GO accessionTerm nameEvidence codeGo category
GO:0005730 nucleolus
 IDA cellular component
GO:0017121 plasma membrane phospholi
pid scrambling
 IBA biological process
GO:0017128 phospholipid scramblase a
ctivity
 IBA molecular function
GO:0005886 plasma membrane
 IBA cellular component
GO:0048471 perinuclear region of cyt
oplasm
 IDA cellular component
GO:0005886 plasma membrane
 IDA cellular component
GO:0005737 cytoplasm
 IDA cellular component
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0017121 plasma membrane phospholi
pid scrambling
 IEA biological process
GO:0017128 phospholipid scramblase a
ctivity
 IEA molecular function
GO:0051607 defense response to virus
 IEA biological process
GO:0017124 SH3 domain binding
 IEA molecular function
GO:0005634 nucleus
 IEA cellular component
GO:0005886 plasma membrane
 IEA cellular component
GO:0005737 cytoplasm
 IEA cellular component
GO:0003677 DNA binding
 IEA molecular function
GO:0016021 integral component of mem
brane
 IEA cellular component
GO:0016020 membrane
 IEA cellular component
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0048471 perinuclear region of cyt
oplasm
 IEA cellular component
GO:0016020 membrane
 IEA cellular component
GO:0005886 plasma membrane
 IEA cellular component
GO:0005634 nucleus
 IEA cellular component
GO:0005737 cytoplasm
 IEA cellular component
GO:0005654 nucleoplasm
 IDA cellular component
GO:0005886 plasma membrane
 IDA cellular component
GO:0005794 Golgi apparatus
 IDA cellular component
GO:2000373 positive regulation of DN
A topoisomerase (ATP-hydr
olyzing) activity
 IDA biological process
GO:0045944 positive regulation of tr
anscription by RNA polyme
rase II
 IDA biological process
GO:0005887 integral component of pla
sma membrane
 IDA cellular component
GO:0005887 integral component of pla
sma membrane
 IDA cellular component
GO:0062023 collagen-containing extra
cellular matrix
 IDA cellular component
GO:0017128 phospholipid scramblase a
ctivity
 IDA molecular function
GO:0017121 plasma membrane phospholi
pid scrambling
 IDA biological process
GO:0005730 nucleolus
 IDA cellular component
GO:0001228 DNA-binding transcription
activator activity, RNA
polymerase II-specific
 IDA molecular function
GO:0006915 apoptotic process
 IDA biological process
GO:0005886 plasma membrane
 IDA cellular component
GO:0005886 plasma membrane
 IDA cellular component
GO:0005886 plasma membrane
 IDA cellular component
GO:0045121 membrane raft
 IDA cellular component
GO:0017128 phospholipid scramblase a
ctivity
 IDA molecular function
GO:0017128 phospholipid scramblase a
ctivity
 IDA molecular function
GO:0017124 SH3 domain binding
 IDA molecular function
GO:0017121 plasma membrane phospholi
pid scrambling
 IDA biological process
GO:0017121 plasma membrane phospholi
pid scrambling
 IDA biological process
GO:0005829 cytosol
 IDA cellular component
GO:0005794 Golgi apparatus
 IDA cellular component
GO:0005509 calcium ion binding
 IDA molecular function
GO:0005634 nucleus
 IDA cellular component
GO:0060368 regulation of Fc receptor
mediated stimulatory sig
naling pathway
 ISS biological process
GO:0045089 positive regulation of in
nate immune response
 IMP biological process
GO:0035456 response to interferon-be
ta
 IMP biological process
GO:0019899 enzyme binding
 IPI molecular function
GO:0019899 enzyme binding
 IPI molecular function
GO:0006953 acute-phase response
 ISS biological process
GO:0070062 extracellular exosome
 HDA cellular component
GO:0030168 platelet activation
 NAS biological process
GO:0010628 positive regulation of ge
ne expression
 IMP biological process
GO:0005509 calcium ion binding
 NAS molecular function
GO:0005154 epidermal growth factor r
eceptor binding
 IPI molecular function
GO:0016020 membrane
 HDA cellular component
GO:0019899 enzyme binding
 IPI molecular function
GO:0019899 enzyme binding
 IPI molecular function
GO:0006659 phosphatidylserine biosyn
thetic process
 ISS biological process
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0070062 extracellular exosome
 HDA cellular component
GO:0051607 defense response to virus
 IMP biological process
GO:0045071 negative regulation of vi
ral genome replication
 IMP biological process
GO:0042609 CD4 receptor binding
 IPI molecular function
GO:0033003 regulation of mast cell a
ctivation
 ISS biological process

Diseases

Expand All | Collapse All
Associated diseases References
Teratozoospermia MIK: 17327269

PubMed references

Expand All | Collapse All
PMID Condition Mutation Ethnicity Population details Infertility_type Associated_genes Abstract
17327269 Teratozoos
permia
19 (6 controls
, 13 cases)
 Male infertility GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
 Show abstract