• Gene id: 5356

Gene Summary

• Gene Symbol: PLRG1   Gene   UCSC   Ensembl
• Aliases: Cwc1, PRL1, PRP46, PRPF46, TANGO4
• Gene name: pleiotropic regulator 1
• Alternate names: pleiotropic regulator 1, pleiotropic regulator 1 (PRL1 homolog, Arabidopsis), transport and golgi organization 4 homolog,
• Gene location: 4q31.3 (72848474: 72725701)     Exons: 18     NC_000003.12
• Gene summary(Entrez): This gene encodes a core component of the cell division cycle 5-like (CDC5L) complex. The CDC5L complex is part of the spliceosome and is required for pre-mRNA splicing. The encoded protein plays a critical role in alternative splice site selection. Alter
• OMIM: 605961

Protein Summary

• Protein general information: O43660  
  • Name: Pleiotropic regulator 1
  • Length: 514  
  • Mass: 57194
• Sequence:

  MVEEVQKHSVHTLVFRSLKRTHDMFVADNGKPVPLDEESHKRKMAIKLRNEYGPVLHMPTSKENLKEKGPQNATD
  SYVHKQYPANQGQEVEYFVAGTHPYPPGPGVALTADTKIQRMPSESAAQSLAVALPLQTKADANRTAPSGSEYRH
  PGASDRPQPTAMNSIVMETGNTKNSALMAKKAPTMPKPQWHPPWKLYRVISGHLGWVRCIAVEPGNQWFVTGSAD
  RTIKIWDLASGKLKLSLTGHISTVRGVIVSTRSPYLFSCGEDKQVKCWDLEYNKVIRHYHGHLSAVYGLDLHPTI
  DVLVTCSRDSTARIWDVRTKASVHTLSGHTNAVATVRCQAAEPQIITGSHDTTIRLWDLVAGKTRVTLTNHKKSV
  RAVVLHPRHYTFASGSPDNIKQWKFPDGSFIQNLSGHNAIINTLTVNSDGVLVSGADNGTMHLWDWRTGYNFQRV
  HAAVQPGSLDSESGIFACAFDQSESRLLTAEADKTIKVYREDDTATEETHPVSWKPEIIKRKRF

• Structural information:
  • Interpro: IPR020472  IPR015943  IPR001680  IPR019775  IPR017986   IPR036322  
  • Prosite: PS00678 PS50082 PS50294
  • PDB: 4YVD 5MQF 5XJC 5YZG 5Z56 5Z57 5Z58 6FF4 6FF7 6ICZ 6ID0 6ID1 6QDV
  • PDBsum: 4YVD 5MQF 5XJC 5YZG 5Z56 5Z57 5Z58 6FF4 6FF7 6ICZ 6ID0 6ID1 6QDV
  • STRING: ENSP00000424417
• Other Databases: GeneCards:  PLRG1  Malacards:  PLRG1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0071013	catalytic step 2 spliceosome	IBA	cellular component
GO:0000974	Prp19 complex	IBA	cellular component
GO:0000398	mRNA splicing, via spliceosome	IBA	biological process
GO:0080008	Cul4-RING E3 ubiquitin ligase complex	IBA	cellular component
GO:0005662	DNA replication factor A complex	IBA	colocalizes with
GO:0071013	catalytic step 2 spliceosome	IDA	cellular component
GO:0000398	mRNA splicing, via spliceosome	IC	biological process
GO:0000398	mRNA splicing, via spliceosome	IDA	biological process
GO:0071007	U2-type catalytic step 2 spliceosome	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0005662	DNA replication factor A complex	IDA	colocalizes with
GO:0005681	spliceosomal complex	IEA	cellular component
GO:0008380	RNA splicing	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0006397	mRNA processing	IEA	biological process
GO:0000398	mRNA splicing, via spliceosome	TAS	biological process
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:1900087	positive regulation of G1/S transition of mitotic cell cycle	IEA	biological process
GO:0034504	protein localization to nucleus	IEA	biological process
GO:0016607	nuclear speck	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0001650	fibrillar center	IDA	cellular component
GO:0031965	nuclear membrane	IDA	cellular component
GO:0016607	nuclear speck	IDA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function

KEGG pathways

Pathway id	Pathway name
hsa03040	Spliceosome

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)