• Gene id: 5350

Gene Summary

• Gene Symbol: PLN   Gene   UCSC   Ensembl
• Aliases: CMD1P, CMH18, PLB
• Gene name: phospholamban
• Alternate names: cardiac phospholamban,
• Gene location: 6q22.31 (118548295: 118561715)     Exons: 2     NC_000006.12
• Gene summary(Entrez): The protein encoded by this gene is found as a pentamer and is a major substrate for the cAMP-dependent protein kinase in cardiac muscle. The encoded protein is an inhibitor of cardiac muscle sarcoplasmic reticulum Ca(2+)-ATPase in the unphosphorylated st
• OMIM: 172405

Protein Summary

• Protein general information: P26678  
  • Name: Cardiac phospholamban (PLB)
  • Length: 52  
  • Mass: 6109
  • Tissue specificity: Heart muscle (at protein level). {ECO
• Sequence:

  MEKVQYLTRSAIRRASTIEMPQQARQKLQNLFINFCLILICLLLICIIVMLL

• Structural information:
  • Interpro: IPR005984  
  • PDB: 1K9N 1KCH 1PLN 1PLP 1PSL 1ZLL 2HYN
  • PDBsum: 1K9N 1KCH 1PLN 1PLP 1PSL 1ZLL 2HYN
  • DIP: 33582
  • STRING: ENSP00000350132
• Other Databases: GeneCards:  PLN  Malacards:  PLN

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:1901894	regulation of ATPase-coupled calcium transmembrane transporter activity	IDA	biological process
GO:0051924	regulation of calcium ion transport	IDA	biological process
GO:0042803	protein homodimerization activity	ISS	molecular function
GO:0033017	sarcoplasmic reticulum membrane	ISS	cellular component
GO:1902081	negative regulation of calcium ion import into sarcoplasmic reticulum	ISS	biological process
GO:0005246	calcium channel regulator activity	IEA	molecular function
GO:0006816	calcium ion transport	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0042030	ATPase inhibitor activity	IEA	molecular function
GO:0016529	sarcoplasmic reticulum	IEA	cellular component
GO:0005783	endoplasmic reticulum	IEA	cellular component
GO:0005739	mitochondrion	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0008015	blood circulation	NAS	biological process
GO:0033017	sarcoplasmic reticulum membrane	TAS	cellular component
GO:0033017	sarcoplasmic reticulum membrane	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:1901895	negative regulation of ATPase-coupled calcium transmembrane transporter activity	IEA	biological process
GO:1901877	negative regulation of calcium ion binding	IEA	biological process
GO:1901077	regulation of relaxation of muscle	IEA	biological process
GO:0090279	regulation of calcium ion import	IEA	biological process
GO:0086023	adenylate cyclase-activating adrenergic receptor signaling pathway involved in heart process	IEA	biological process
GO:0045822	negative regulation of heart contraction	IEA	biological process
GO:0042803	protein homodimerization activity	IEA	molecular function
GO:0016529	sarcoplasmic reticulum	IEA	cellular component
GO:0010881	regulation of cardiac muscle contraction by regulation of the release of sequestered calcium ion	IEA	biological process
GO:0010880	regulation of release of sequestered calcium ion into cytosol by sarcoplasmic reticulum	IEA	biological process
GO:0008016	regulation of heart contraction	IEA	biological process
GO:0007219	Notch signaling pathway	IEA	biological process
GO:0006874	cellular calcium ion homeostasis	IEA	biological process
GO:0005789	endoplasmic reticulum membrane	IEA	cellular component
GO:0032991	protein-containing complex	IEA	cellular component
GO:0032868	response to insulin	IEA	biological process
GO:0016529	sarcoplasmic reticulum	IEA	cellular component
GO:0010043	response to zinc ion	IEA	biological process
GO:0006816	calcium ion transport	IEA	biological process
GO:1902081	negative regulation of calcium ion import into sarcoplasmic reticulum	IEA	biological process
GO:0086092	regulation of the force of heart contraction by cardiac conduction	IEA	biological process
GO:0086004	regulation of cardiac muscle cell contraction	IEA	biological process
GO:0060314	regulation of ryanodine-sensitive calcium-release channel activity	IEA	biological process
GO:0048738	cardiac muscle tissue development	IEA	biological process
GO:0033017	sarcoplasmic reticulum membrane	IEA	cellular component
GO:0002026	regulation of the force of heart contraction	IEA	biological process
GO:0042802	identical protein binding	IEA	molecular function
GO:0042030	ATPase inhibitor activity	IEA	molecular function
GO:0033574	response to testosterone	IEA	biological process
GO:0031982	vesicle	IEA	cellular component
GO:0004857	enzyme inhibitor activity	ISS	molecular function
GO:0042030	ATPase inhibitor activity	IDA	molecular function
GO:0042030	ATPase inhibitor activity	ISS	molecular function
GO:0042802	identical protein binding	ISS	molecular function
GO:0051117	ATPase binding	ISS	molecular function
GO:0032780	negative regulation of ATPase activity	IDA	biological process
GO:0051480	regulation of cytosolic calcium ion concentration	IC	biological process
GO:0051926	negative regulation of calcium ion transport	IDA	biological process
GO:0090534	calcium ion-transporting ATPase complex	IDA	cellular component
GO:1901877	negative regulation of calcium ion binding	IDA	biological process
GO:1901895	negative regulation of ATPase-coupled calcium transmembrane transporter activity	IDA	biological process
GO:0005783	endoplasmic reticulum	ISS	cellular component
GO:0008016	regulation of heart contraction	IMP	biological process
GO:0032780	negative regulation of ATPase activity	ISS	biological process
GO:0043086	negative regulation of catalytic activity	ISS	biological process
GO:0048471	perinuclear region of cytoplasm	ISS	cellular component
GO:1901877	negative regulation of calcium ion binding	ISS	biological process
GO:1901877	negative regulation of calcium ion binding	ISS	biological process
GO:0002026	regulation of the force of heart contraction	IC	biological process
GO:0016020	membrane	IDA	cellular component
GO:0086004	regulation of cardiac muscle cell contraction	IC	biological process
GO:0086036	regulation of cardiac muscle cell membrane potential	IC	biological process
GO:1901020	negative regulation of calcium ion transmembrane transporter activity	IDA	biological process
GO:1901897	regulation of relaxation of cardiac muscle	IC	biological process
GO:0010459	negative regulation of heart rate	IMP	biological process
GO:0055119	relaxation of cardiac muscle	TAS	biological process
GO:0090281	negative regulation of calcium ion import	ISS	biological process
GO:1901020	negative regulation of calcium ion transmembrane transporter activity	ISS	biological process
GO:1901020	negative regulation of calcium ion transmembrane transporter activity	ISS	biological process
GO:1902081	negative regulation of calcium ion import into sarcoplasmic reticulum	ISS	biological process
GO:0005789	endoplasmic reticulum membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0033017	sarcoplasmic reticulum membrane	IEA	cellular component
GO:0031966	mitochondrial membrane	IEA	cellular component
GO:0005739	mitochondrion	HDA	cellular component
GO:0051924	regulation of calcium ion transport	ISS	biological process

KEGG pathways

Pathway id	Pathway name
hsa04024	cAMP signaling pathway
hsa04020	Calcium signaling pathway
hsa04022	cGMP-PKG signaling pathway
hsa04261	Adrenergic signaling in cardiomyocytes
hsa04919	Thyroid hormone signaling pathway
hsa05414	Dilated cardiomyopathy

Diseases

Associated diseases	References
Dilated cardiomyopathy	KEGG:H00294
Dilated cardiomyopathy	KEGG:H00294
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)