• Gene id: 5347

Gene Summary

• Gene Symbol: PLK1   Gene   UCSC   Ensembl
• Aliases: PLK, STPK13
• Gene name: polo like kinase 1
• Alternate names: serine/threonine-protein kinase PLK1, PLK-1, cell cycle regulated protein kinase, polo (Drosophia)-like kinase, serine/threonine-protein kinase 13,
• Gene location: 16p12.2 (23678888: 23690366)     Exons: 1     NC_000016.10
• Gene summary(Entrez): The Ser/Thr protein kinase encoded by this gene belongs to the CDC5/Polo subfamily. It is highly expressed during mitosis and elevated levels are found in many different types of cancer. Depletion of this protein in cancer cells dramatically inhibited cel
• OMIM: 602098

Protein Summary

• Protein general information: P53350  
  • Name: Serine/threonine protein kinase PLK1 (EC 2.7.11.21) (Polo like kinase 1) (PLK 1) (Serine/threonine protein kinase 13) (STPK13)
  • Length: 603  
  • Mass: 68255
  • Tissue specificity: Placenta and colon.
• Sequence:

  MSAAVTAGKLARAPADPGKAGVPGVAAPGAPAAAPPAKEIPEVLVDPRSRRRYVRGRFLGKGGFAKCFEISDADT
  KEVFAGKIVPKSLLLKPHQREKMSMEISIHRSLAHQHVVGFHGFFEDNDFVFVVLELCRRRSLLELHKRRKALTE
  PEARYYLRQIVLGCQYLHRNRVIHRDLKLGNLFLNEDLEVKIGDFGLATKVEYDGERKKTLCGTPNYIAPEVLSK
  KGHSFEVDVWSIGCIMYTLLVGKPPFETSCLKETYLRIKKNEYSIPKHINPVAASLIQKMLQTDPTARPTINELL
  NDEFFTSGYIPARLPITCLTIPPRFSIAPSSLDPSNRKPLTVLNKGLENPLPERPREKEEPVVRETGEVVDCHLS
  DMLQQLHSVNASKPSERGLVRQEEAEDPACIPIFWVSKWVDYSDKYGLGYQLCDNSVGVLFNDSTRLILYNDGDS
  LQYIERDGTESYLTVSSHPNSLMKKITLLKYFRNYMSEHLLKAGANITPREGDELARLPYLRTWFRTRSAIILHL
  SNGSVQINFFQDHTKLILCPLMAAVTYIDEKRDFRTYRLSLLEEYGCCKELASRLRYARTMVDKLLSSRSASNRL
  KAS

• Structural information:
  • Protein Domains: (53..30-)
    (/note="Protein-kinase)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00159-)
    (417..48-)
    1 (/note="POLO-box)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00154-)
    (515..58-)
    2 (/note="POLO-box)
    (/evidence="ECO:0000255|PROSITE-ProR-)
  • Interpro: IPR011009  IPR033702  IPR033701  IPR033695  IPR000959   IPR036947  IPR000719  IPR017441  IPR008271  
  • Prosite: PS50078 PS00107 PS50011 PS00108
  • CDD: cd13118 cd13117 cd14187
  • PDB: 1Q4K 1Q4O 1UMW 2OGQ 2OJX 2OU7 2OWB 2RKU 2V5Q 2YAC 3BZI 3C5L 3FC2 3FVH 3HIH 3HIK 3KB7 3P2W 3P2Z 3P34 3P35 3P36 3P37 3Q1I 3RQ7 3THB 4A4L 4A4O 4DFW 4E67 4E9C 4E9D 4H5X 4H71 4HAB 4HCO 4HY2 4J52 4J53 4LKL 4LKM 4O56 4O6W 4O9W 4RCP 4WHH 4WHK 4WHL 4X9R 4X9V 4X9W 5J19 5NEI 5NFU 5NJE 5NMM 5NN1 5NN2 5TA6 5TA8 6AX4 6GY2
  • PDBsum: 1Q4K 1Q4O 1UMW 2OGQ 2OJX 2OU7 2OWB 2RKU 2V5Q 2YAC 3BZI 3C5L 3FC2 3FVH 3HIH 3HIK 3KB7 3P2W 3P2Z 3P34 3P35 3P36 3P37 3Q1I 3RQ7 3THB 4A4L 4A4O 4DFW 4E67 4E9C 4E9D 4H5X 4H71 4HAB 4HCO 4HY2 4J52 4J53 4LKL 4LKM 4O56 4O6W 4O9W 4RCP 4WHH 4WHK 4WHL 4X9R 4X9V 4X9W 5J19 5NEI 5NFU 5NJE 5NMM 5NN1 5NN2 5TA6 5TA8 6AX4 6GY2
  • DIP: 29696
  • STRING: ENSP00000300093
• Other Databases: GeneCards:  PLK1  Malacards:  PLK1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:1901673	regulation of mitotic spindle assembly	IDA	biological process
GO:0005813	centrosome	IDA	cellular component
GO:0006468	protein phosphorylation	IDA	biological process
GO:0005813	centrosome	IBA	cellular component
GO:0000278	mitotic cell cycle	IBA	biological process
GO:0032465	regulation of cytokinesis	IBA	biological process
GO:0005737	cytoplasm	IBA	cellular component
GO:0005634	nucleus	IBA	cellular component
GO:0004674	protein serine/threonine kinase activity	IBA	molecular function
GO:0000922	spindle pole	IBA	cellular component
GO:0072425	signal transduction involved in G2 DNA damage checkpoint	IDA	biological process
GO:0008017	microtubule binding	IDA	molecular function
GO:1904668	positive regulation of ubiquitin protein ligase activity	IDA	biological process
GO:0000278	mitotic cell cycle	IDA	biological process
GO:0005813	centrosome	IDA	cellular component
GO:0005813	centrosome	IDA	cellular component
GO:0005813	centrosome	IDA	cellular component
GO:0005813	centrosome	IDA	cellular component
GO:0005813	centrosome	IDA	cellular component
GO:0005813	centrosome	IDA	cellular component
GO:0000776	kinetochore	IDA	cellular component
GO:0000776	kinetochore	IDA	cellular component
GO:0000776	kinetochore	IDA	cellular component
GO:0000776	kinetochore	IDA	cellular component
GO:0000086	G2/M transition of mitotic cell cycle	IDA	biological process
GO:0071168	protein localization to chromatin	IDA	biological process
GO:0051233	spindle midzone	IDA	cellular component
GO:0030496	midbody	IDA	cellular component
GO:0006468	protein phosphorylation	IDA	biological process
GO:0005819	spindle	IDA	cellular component
GO:0005819	spindle	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0004674	protein serine/threonine kinase activity	IDA	molecular function
GO:0004674	protein serine/threonine kinase activity	IDA	molecular function
GO:0004674	protein serine/threonine kinase activity	IDA	molecular function
GO:0004674	protein serine/threonine kinase activity	IDA	molecular function
GO:0004674	protein serine/threonine kinase activity	IDA	molecular function
GO:0004674	protein serine/threonine kinase activity	IDA	molecular function
GO:0004674	protein serine/threonine kinase activity	IDA	molecular function
GO:0004674	protein serine/threonine kinase activity	IDA	molecular function
GO:0004674	protein serine/threonine kinase activity	IDA	molecular function
GO:0004672	protein kinase activity	IDA	molecular function
GO:0001578	microtubule bundle formation	IDA	biological process
GO:0032465	regulation of cytokinesis	IDA	biological process
GO:0000281	mitotic cytokinesis	IDA	biological process
GO:0000776	kinetochore	IDA	cellular component
GO:0006468	protein phosphorylation	IDA	biological process
GO:0051443	positive regulation of ubiquitin-protein transferase activity	IMP	biological process
GO:0043066	negative regulation of apoptotic process	IMP	biological process
GO:0032436	positive regulation of proteasomal ubiquitin-dependent protein catabolic process	IMP	biological process
GO:0010997	anaphase-promoting complex binding	IPI	molecular function
GO:0000278	mitotic cell cycle	IMP	biological process
GO:0090435	protein localization to nuclear envelope	IMP	biological process
GO:0051081	nuclear envelope disassembly	IMP	biological process
GO:0007098	centrosome cycle	IMP	biological process
GO:0007098	centrosome cycle	IMP	biological process
GO:0019901	protein kinase binding	IPI	molecular function
GO:0019901	protein kinase binding	IPI	molecular function
GO:0007346	regulation of mitotic cell cycle	IMP	biological process
GO:0007094	mitotic spindle assembly checkpoint	IMP	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0004674	protein serine/threonine kinase activity	IMP	molecular function
GO:0004674	protein serine/threonine kinase activity	IMP	molecular function
GO:0032465	regulation of cytokinesis	IMP	biological process
GO:0000122	negative regulation of transcription by RNA polymerase II	IMP	biological process
GO:0000070	mitotic sister chromatid segregation	IMP	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0004672	protein kinase activity	IEA	molecular function
GO:0005524	ATP binding	IEA	molecular function
GO:0006468	protein phosphorylation	IEA	biological process
GO:0000776	kinetochore	IEA	cellular component
GO:0051301	cell division	IEA	biological process
GO:0016301	kinase activity	IEA	molecular function
GO:0016740	transferase activity	IEA	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0005856	cytoskeleton	IEA	cellular component
GO:0005524	ATP binding	IEA	molecular function
GO:0000775	chromosome, centromeric region	IEA	cellular component
GO:0005694	chromosome	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0004674	protein serine/threonine kinase activity	IEA	molecular function
GO:0016310	phosphorylation	IEA	biological process
GO:0007049	cell cycle	IEA	biological process
GO:0000166	nucleotide binding	IEA	molecular function
GO:0000278	mitotic cell cycle	TAS	biological process
GO:0004672	protein kinase activity	IDA	molecular function
GO:0000922	spindle pole	IDA	cellular component
GO:0045184	establishment of protein localization	IMP	biological process
GO:0004674	protein serine/threonine kinase activity	EXP	molecular function
GO:0004674	protein serine/threonine kinase activity	EXP	molecular function
GO:0031145	anaphase-promoting complex-dependent catabolic process	TAS	biological process
GO:1900182	positive regulation of protein localization to nucleus	TAS	biological process
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0006511	ubiquitin-dependent protein catabolic process	TAS	biological process
GO:0007062	sister chromatid cohesion	TAS	biological process
GO:0007062	sister chromatid cohesion	TAS	biological process
GO:0007077	mitotic nuclear envelope disassembly	TAS	biological process
GO:0010389	regulation of G2/M transition of mitotic cell cycle	TAS	biological process
GO:0016301	kinase activity	TAS	molecular function
GO:0016301	kinase activity	TAS	molecular function
GO:0051726	regulation of cell cycle	TAS	biological process
GO:0051726	regulation of cell cycle	TAS	biological process
GO:0051726	regulation of cell cycle	TAS	biological process
GO:0051726	regulation of cell cycle	TAS	biological process
GO:0097711	ciliary basal body-plasma membrane docking	TAS	biological process
GO:1901990	regulation of mitotic cell cycle phase transition	TAS	biological process
GO:1902749	regulation of cell cycle G2/M phase transition	TAS	biological process
GO:1904668	positive regulation of ubiquitin protein ligase activity	TAS	biological process
GO:1904668	positive regulation of ubiquitin protein ligase activity	TAS	biological process
GO:0004674	protein serine/threonine kinase activity	TAS	molecular function
GO:0004674	protein serine/threonine kinase activity	TAS	molecular function
GO:0004674	protein serine/threonine kinase activity	TAS	molecular function
GO:0004674	protein serine/threonine kinase activity	TAS	molecular function
GO:0004674	protein serine/threonine kinase activity	TAS	molecular function
GO:0004674	protein serine/threonine kinase activity	TAS	molecular function
GO:0004674	protein serine/threonine kinase activity	TAS	molecular function
GO:0004674	protein serine/threonine kinase activity	TAS	molecular function
GO:0004674	protein serine/threonine kinase activity	TAS	molecular function
GO:0004674	protein serine/threonine kinase activity	TAS	molecular function
GO:0004674	protein serine/threonine kinase activity	TAS	molecular function
GO:0004674	protein serine/threonine kinase activity	TAS	molecular function
GO:0004674	protein serine/threonine kinase activity	TAS	molecular function
GO:0004674	protein serine/threonine kinase activity	TAS	molecular function
GO:0000086	G2/M transition of mitotic cell cycle	TAS	biological process
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005813	centrosome	IDA	cellular component
GO:0042802	identical protein binding	IPI	molecular function
GO:0042802	identical protein binding	IPI	molecular function
GO:0042802	identical protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0070194	synaptonemal complex disassembly	IEA	biological process
GO:0045143	homologous chromosome segregation	IEA	biological process
GO:0043393	regulation of protein binding	IEA	biological process
GO:0034451	centriolar satellite	IEA	cellular component
GO:0033365	protein localization to organelle	IEA	biological process
GO:0016321	female meiosis chromosome segregation	IEA	biological process
GO:0006468	protein phosphorylation	IEA	biological process
GO:0005814	centriole	IEA	cellular component
GO:0004674	protein serine/threonine kinase activity	IEA	molecular function
GO:0004672	protein kinase activity	IEA	molecular function
GO:0000785	chromatin	IEA	cellular component
GO:0000780	condensed nuclear chromosome, centromeric region	IEA	cellular component
GO:0018105	peptidyl-serine phosphorylation	IEA	biological process
GO:0000795	synaptonemal complex	IEA	cellular component
GO:0000776	kinetochore	IEA	cellular component
GO:0004672	protein kinase activity	IDA	molecular function
GO:0004674	protein serine/threonine kinase activity	IMP	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0019901	protein kinase binding	IPI	molecular function
GO:0000776	kinetochore	IDA	cellular component
GO:0000942	condensed nuclear chromosome outer kinetochore	IDA	cellular component
GO:0005813	centrosome	IDA	cellular component
GO:0015630	microtubule cytoskeleton	IDA	cellular component
GO:0030071	regulation of mitotic metaphase/anaphase transition	IMP	biological process
GO:0045736	negative regulation of cyclin-dependent protein serine/threonine kinase activity	IMP	biological process
GO:0000922	spindle pole	IDA	cellular component
GO:0005876	spindle microtubule	IDA	colocalizes with
GO:0051233	spindle midzone	IDA	cellular component
GO:0010800	positive regulation of peptidyl-threonine phosphorylation	IMP	biological process
GO:0043393	regulation of protein binding	IMP	biological process
GO:0005819	spindle	IEA	cellular component
GO:0005815	microtubule organizing center	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0000777	condensed chromosome kinetochore	IEA	cellular component
GO:0030496	midbody	IEA	cellular component
GO:0006468	protein phosphorylation	IMP	biological process
GO:0004672	protein kinase activity	IMP	molecular function
GO:0000287	magnesium ion binding	IMP	molecular function
GO:0005524	ATP binding	IMP	molecular function
GO:0000776	kinetochore	IDA	cellular component
GO:0005813	centrosome	IDA	cellular component
GO:0000132	establishment of mitotic spindle orientation	IDA	biological process
GO:0030071	regulation of mitotic metaphase/anaphase transition	IDA	biological process
GO:0045862	positive regulation of proteolysis	IDA	biological process
GO:0031648	protein destabilization	IDA	biological process
GO:1904776	regulation of protein localization to cell cortex	IDA	biological process
GO:0006468	protein phosphorylation	IDA	biological process
GO:0004674	protein serine/threonine kinase activity	IDA	molecular function
GO:0016567	protein ubiquitination	IDA	biological process
GO:0018105	peptidyl-serine phosphorylation	IDA	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function

KEGG pathways

Pathway id	Pathway name
hsa04110	Cell cycle
hsa04114	Oocyte meiosis
hsa04068	FoxO signaling pathway
hsa04914	Progesterone-mediated oocyte maturation

Diseases

Associated diseases	References
Prostate cancer	PMID:15948124
urinary bladder cancer	PMID:16837776
urinary bladder cancer	PMID:15761500
ovary epithelial cancer	PMID:14970859
Endometriosis	PMID:18353325
Breast carcinoma	PMID:15785925
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200
Non obstructive azoospermia	MIK: 24012201
Sertoli cell only syndrome	MIK: 23869807

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
24012201	Non obstructive azoospermia			31 (4 controls, 27 cases)	Male infertility	GSE45885 analyzed by GEO2R (cutoff 1.5 fold)
23869807	Non obstructive azoospermia, Sertoli cell only syndrome			20 (4 controls, 16 cases)	Male infertility	GSE45887 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq