• Gene id: 53344

Gene Summary

• Gene Symbol: CHIC1   Gene   UCSC   Ensembl
• Aliases: BRX
• Gene name: cysteine rich hydrophobic domain 1
• Alternate names: cysteine-rich hydrophobic domain-containing protein 1, brain X-linked protein,
• Gene location: Xq13.2 (73563044: 73687108)     Exons: 9     NC_000023.11
• Gene summary(Entrez): This gene encodes a cysteine-rich hydrophobic (CHIC) domain-containing protein, and is one of the few protein-coding genes found near the X-inactivation center. Studies in mouse indicate that the mouse ortholog of this gene is subject to X-inactivation in
• OMIM: 300922

Protein Summary

• Protein general information: Q5VXU3  
  • Name: Cysteine rich hydrophobic domain containing protein 1 (Brain X linked protein)
  • Length: 224  
  • Mass: 25616
  • Tissue specificity: Equally expressed in various parts of the brain. {ECO
• Sequence:

  MSILLPNMAEFDTISELEEEEEEEAATSSSSPSSSSSVSGPDDDEEDEEEEEEEEEEEEEEEEEEEEEAPPPPRV
  VSEEHLRRYAPDPVLVRGAGHITVFGLSNKFDTEFPSVLTGKVAPEEFKTSIGRVNACLKKALPVNVKWLLCGCL
  CCCCTLGCSLWPVICLNKRTRRSIQKLIEWENNRLYHKLALHWKLTKRKCETSNMMEYVILIEFLPKYPIFRPD

• Structural information:
  • Interpro: IPR039735  IPR019383  
  • STRING: ENSP00000362601
• Other Databases: GeneCards:  CHIC1  Malacards:  CHIC1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0031410	cytoplasmic vesicle	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)