• Gene id: 53342

Gene Summary

• Gene Symbol: IL17D   Gene   UCSC   Ensembl
• Aliases: IL-17D
• Gene name: interleukin 17D
• Alternate names: interleukin-17D,
• Gene location: 13q12.11 (20701104: 20723099)     Exons: 5     NC_000013.11
• Gene summary(Entrez): The protein encoded by this gene is a cytokine that shares the sequence similarity with IL17. The treatment of endothelial cells with this cytokine has been shown to stimulate the production of other cytokines including IL6, IL8 and CSF2/ GM-CSF. The incr
• OMIM: 607587

Protein Summary

• Protein general information: Q8TAD2  
  • Name: Interleukin 17D (IL 17D) (Interleukin 27) (IL 27)
  • Length: 202  
  • Mass: 21893
  • Tissue specificity: Expressed preferentially in adipose, skeletal muscle and CNS. {ECO
• Sequence:

  MLVAGFLLALPPSWAAGAPRAGRRPARPRGCADRPEELLEQLYGRLAAGVLSAFHHTLQLGPREQARNASCPAGG
  RPADRRFRPPTNLRSVSPWAYRISYDPARYPRYLPEAYCLCRGCLTGLFGEEDVRFRSAPVYMPTVVLRRTPACA
  GGRSVYTEAYVTIPVGCTCVPEPEKDADSINSSIDKQGAKLLLGPNDAPAGP

• Structural information:
  • Interpro: IPR029034  IPR020440  IPR010345  
  • STRING: ENSP00000302924
• Other Databases: GeneCards:  IL17D  Malacards:  IL17D

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005125	cytokine activity	IEA	molecular function
GO:0005576	extracellular region	IEA	cellular component
GO:0006954	inflammatory response	IEA	biological process
GO:0005615	extracellular space	IEA	cellular component
GO:0005576	extracellular region	IEA	cellular component
GO:0005125	cytokine activity	IEA	molecular function
GO:0005576	extracellular region	IEA	cellular component
GO:0007165	signal transduction	IEA	biological process
GO:0007165	signal transduction	IEA	biological process
GO:0007165	signal transduction	IEA	biological process
GO:0006954	inflammatory response	IDA	biological process
GO:0048018	receptor ligand activity	IDA	molecular function
GO:0005615	extracellular space	IDA	cellular component
GO:0042803	protein homodimerization activity	IDA	molecular function
GO:0005125	cytokine activity	IDA	molecular function
GO:0032755	positive regulation of interleukin-6 production	IDA	biological process
GO:0032757	positive regulation of interleukin-8 production	IDA	biological process
GO:0032725	positive regulation of granulocyte macrophage colony-stimulating factor production	IDA	biological process
GO:1900017	positive regulation of cytokine production involved in inflammatory response	IDA	biological process
GO:1903707	negative regulation of hemopoiesis	IDA	biological process

KEGG pathways

Pathway id	Pathway name
hsa04060	Cytokine-cytokine receptor interaction
hsa04630	JAK-STAT signaling pathway
hsa04625	C-type lectin receptor signaling pathway
hsa04659	Th17 cell differentiation
hsa04657	IL-17 signaling pathway

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200
Teratozoospermia	MIK: 17327269
Unexplained infertility	MIK: 25753583

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
25753583	Unexplained infertility			46 (17 fertile men, 29 male patients)	Male infertility	Microarray