• Gene id: 53340

Gene Summary

• Gene Symbol: SPA17   Gene   UCSC   Ensembl
• Aliases: CT22, SP17, SP17-1
• Gene name: sperm autoantigenic protein 17
• Alternate names: sperm surface protein Sp17, cancer/testis antigen 22, sperm protein 17,
• Gene location: 11q24.2 (124673843: 124694793)     Exons: 6     NC_000011.10
• Gene summary(Entrez): This gene encodes a protein present at the cell surface. The N-terminus has sequence similarity to human cAMP-dependent protein kinase A (PKA) type II alpha regulatory subunit (RIIa) while the C-terminus has an IQ calmodulin-binding motif. The central por
• OMIM: 608621

Protein Summary

• Protein general information: Q15506  
  • Name: Sperm surface protein Sp17 (Cancer/testis antigen 22) (CT22) (Sp17 1) (Sperm autoantigenic protein 17) (Sperm protein 17)
  • Length: 151  
  • Mass: 17,406
• Sequence:

  MSIPFSNTHYRIPQGFGNLLEGLTREILREQPDNIPAFAAAYFESLLEKREKTNFDPAEWGSKVEDRFYNNHAFE
  EQEPPEKSDPKQEESQISGKEEETSVTILDSSEEDKEKEEVAAVKIQAAFRGHIAREEAKKMKTNSLQNEEKEEN
  K

• Structural information:
  • Protein Domains: IQ. (114-143)
  • Interpro: IPR003117  IPR000048  IPR012105  
  • Prosite: PS50096
  • STRING: ENSP00000227135
• Other Databases: GeneCards:  SPA17  Malacards:  SPA17

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0003351	epithelial cilium movement	NAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005737	cytoplasm	IDA	cellular component
GO:0007283	spermatogenesis	TAS	biological process
GO:0007338	single fertilization	TAS	biological process
GO:0007339	binding of sperm to zona pellucida	IEA	biological process
GO:0009897	external side of plasma membrane	IEA	cellular component
GO:0031514	motile cilium	IDA	cellular component
GO:0035686	sperm fibrous sheath	IDA	cellular component
GO:0097228	sperm principal piece	IDA	cellular component
GO:0003351	epithelial cilium movement	NAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0005929	cilium	IEA	cellular component
GO:0007283	spermatogenesis	TAS	biological process
GO:0007338	single fertilization	TAS	biological process
GO:0007339	binding of sperm to zona pellucida	IEA	biological process
GO:0009897	external side of plasma membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0031514	motile cilium	IDA	cellular component
GO:0035686	sperm fibrous sheath	IEA	cellular component
GO:0035686	sperm fibrous sheath	IDA	cellular component
GO:0097228	sperm principal piece	IEA	cellular component
GO:0097228	sperm principal piece	IDA	cellular component
GO:0003351	epithelial cilium movement	NAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005737	cytoplasm	IDA	cellular component
GO:0007283	spermatogenesis	TAS	biological process
GO:0007338	single fertilization	TAS	biological process
GO:0031514	motile cilium	IDA	cellular component
GO:0035686	sperm fibrous sheath	IDA	cellular component
GO:0097228	sperm principal piece	IDA	cellular component

Diseases

Associated diseases	References
Schizophrenia	GAD: 19571808
Male factor infertility	MIK: 17302030
Hypospermatogenesis	MIK: 28361989
Male infertility	MIK: 17302030
Spermatogenic defects	MIK: 31037746
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17302030	Male infertility				Male infertility	Sp17
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
28361989	Hypospermatogenesis			6 (3 controls, 3 Klienfelter syndrome	Male infertility	Microarray
31037746	Spermatogenic defects			28 men with azoospermia	Male infertility	Microarray