• Gene id: 53336

Gene Summary

• Gene Symbol: CPXCR1   Gene   UCSC   Ensembl
• Aliases: CT77
• Gene name: CPX chromosome region candidate 1
• Alternate names: CPX chromosomal region candidate gene 1 protein, cancer/testis antigen 77,
• Gene location: Xq21.31 (88747224: 88754784)     Exons: 3     NC_000023.11
• Gene summary(Entrez): This gene is one of several genes identified in a region of the X chromosome associated with an X-linked cleft palate (CPX) disorder. The encoded protein contains a motif similar to a motif found in zinc-finger proteins. Mutation analysis of this gene has

Protein Summary

• Protein general information: Q8N123  
  • Name: CPX chromosomal region candidate gene 1 protein (Cancer/testis antigen 77) (CT77)
  • Length: 301  
  • Mass: 34727
  • Tissue specificity: Expressed in a variety of fetal tissues. {ECO
• Sequence:

  MSYPTKEGSDTAGNAHKNSENEPPNDCSTDIESPSADPNMIYQVETNPINREPGTATSQEDVVPQAAENSELETE
  IQKDQREEDLKEELLLLQTPIPRKLVSHKPLNDRSRSHSGKVEMKANNFPINHKTRFRLSTSWRVPFINSHEIRS
  MILHLLCDRYFSQAAGCQNTMWVKRKYIACLYHPNSFTHHERAITFRRPSRVHYYRPLTERMTSGKFCKSTDTKG
  KCRFRAIVRSVLFVSQIQIESIFNIKGFVDILTYIHTMNVMITNTNNGWKYFCPICGRLFNTYSELRQHSCSSSG
  N

• Structural information:
  • Interpro: IPR039710  IPR013087  
  • Prosite: PS50157
  • STRING: ENSP00000276127
• Other Databases: GeneCards:  CPXCR1  Malacards:  CPXCR1

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881