• Gene id: 5329

Gene Summary

• Gene Symbol: PLAUR   Gene   UCSC   Ensembl
• Aliases: CD87, U-PAR, UPAR, URKR
• Gene name: plasminogen activator, urokinase receptor
• Alternate names: urokinase plasminogen activator surface receptor, monocyte activation antigen Mo3, u-plasminogen activator receptor form 2, urokinase-type plasminogen activator (uPA) receptor,
• Gene location: 19q13.31 (80134823: 80219408)     Exons: 9     NC_000007.14
• Gene summary(Entrez): This gene encodes the receptor for urokinase plasminogen activator and, given its role in localizing and promoting plasmin formation, likely influences many normal and pathological processes related to cell-surface plasminogen activation and localized deg
• OMIM: 173391

Protein Summary

• Protein general information: Q03405  
  • Name: Urokinase plasminogen activator surface receptor (U PAR) (uPAR) (Monocyte activation antigen Mo3) (CD antigen CD87)
  • Length: 335  
  • Mass: 36,978
• Sequence:

  MGHPPLLPLLLLLHTCVPASWGLRCMQCKTNGDCRVEECALGQDLCRTTIVRLWEEGEELELVEKSCTHSEKTNR
  TLSYRTGLKITSLTEVVCGLDLCNQGNSGRAVTYSRSRYLECISCGSSDMSCERGRHQSLQCRSPEEQCLDVVTH
  WIQEGEEGRPKDDRHLRGCGYLPGCPGSNGFHNNDTFHFLKCCNTTKCNEGPILELENLPQNGRQCYSCKGNSTH
  GCSSEETFLIDCRGPMNQCLVATGTHEPKNQSYMVRGCATASMCQHAHLGDAFSMNHIDVSCCTKSGCNHPDLDV
  QYRSGAAPQPGPAHLSLTITLLMTARLWGGTLLWT

• Structural information:
  • Protein Domains: UPAR/Ly6 (23-114)
    UPAR/Ly6 (115-213)
    UPAR/Ly6 (214-305)
  • Interpro: IPR018363  IPR016054  IPR033084  
  • Prosite: PS00983
  • PDB: 1YWH 2FD6 2I9B 3BT1 3BT2 3U73 3U74 4K24 4QTI
  • PDBsum: 1YWH 2FD6 2I9B 3BT1 3BT2 3U73 3U74 4K24 4QTI
  • DIP: 137
  • STRING: ENSP00000339328
• Other Databases: GeneCards:  PLAUR  Malacards:  PLAUR

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0001934	positive regulation of protein phosphorylation	IMP	biological process
GO:0004872	receptor activity	NAS	molecular function
GO:0004872	receptor activity	NAS	molecular function
GO:0005102	receptor binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005788	endoplasmic reticulum lumen	TAS	cellular component
GO:0005789	endoplasmic reticulum membrane	TAS	cellular component
GO:0005789	endoplasmic reticulum membrane	TAS	cellular component
GO:0005886	plasma membrane	IDA	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005887	integral component of plasma membrane	IEA	cellular component
GO:0005925	focal adhesion	IDA	cellular component
GO:0006928	movement of cell or subcellular component	NAS	biological process
GO:0006935	chemotaxis	TAS	biological process
GO:0007165	signal transduction	TAS	biological process
GO:0007596	blood coagulation	NAS	biological process
GO:0016021	integral component of membrane	NAS	cellular component
GO:0016255	attachment of GPI anchor to protein	TAS	biological process
GO:0019898	extrinsic component of membrane	TAS	cellular component
GO:0019899	enzyme binding	IPI	molecular function
GO:0019904	protein domain specific binding	IPI	molecular function
GO:0030162	regulation of proteolysis	NAS	biological process
GO:0030377	urokinase plasminogen activator receptor activity	IBA	molecular function
GO:0030377	urokinase plasminogen activator receptor activity	NAS	molecular function
GO:0030377	urokinase plasminogen activator receptor activity	NAS	molecular function
GO:0031225	anchored component of membrane	IEA	cellular component
GO:0038195	urokinase plasminogen activator signaling pathway	IBA	biological process
GO:0042730	fibrinolysis	TAS	biological process
GO:0043066	negative regulation of apoptotic process	IMP	biological process
GO:0043388	positive regulation of DNA binding	IDA	biological process
GO:0045742	positive regulation of epidermal growth factor receptor signaling pathway	IMP	biological process
GO:0070062	extracellular exosome	IDA	cellular component
GO:0071438	invadopodium membrane	IEA	cellular component
GO:0090200	positive regulation of release of cytochrome c from mitochondria	IMP	biological process
GO:2001243	negative regulation of intrinsic apoptotic signaling pathway	IMP	biological process
GO:2001268	negative regulation of cysteine-type endopeptidase activity involved in apoptotic signaling pathway	IMP	biological process
GO:0001934	positive regulation of protein phosphorylation	IMP	biological process
GO:0004872	receptor activity	TAS	molecular function
GO:0004872	receptor activity	NAS	molecular function
GO:0004872	receptor activity	NAS	molecular function
GO:0005102	receptor binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005576	extracellular region	IEA	cellular component
GO:0005576	extracellular region	IEA	cellular component
GO:0005788	endoplasmic reticulum lumen	TAS	cellular component
GO:0005789	endoplasmic reticulum membrane	TAS	cellular component
GO:0005789	endoplasmic reticulum membrane	TAS	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	IDA	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005887	integral component of plasma membrane	IEA	cellular component
GO:0005925	focal adhesion	IDA	cellular component
GO:0006928	movement of cell or subcellular component	NAS	biological process
GO:0006935	chemotaxis	TAS	biological process
GO:0007165	signal transduction	TAS	biological process
GO:0007596	blood coagulation	TAS	biological process
GO:0007596	blood coagulation	NAS	biological process
GO:0016020	membrane	IEA	cellular component
GO:0016021	integral component of membrane	NAS	cellular component
GO:0016255	attachment of GPI anchor to protein	TAS	biological process
GO:0019898	extrinsic component of membrane	TAS	cellular component
GO:0019899	enzyme binding	IPI	molecular function
GO:0019904	protein domain specific binding	IPI	molecular function
GO:0030054	cell junction	IEA	cellular component
GO:0030162	regulation of proteolysis	IEA	biological process
GO:0030162	regulation of proteolysis	NAS	biological process
GO:0030377	urokinase plasminogen activator receptor activity	IEA	molecular function
GO:0030377	urokinase plasminogen activator receptor activity	IBA	molecular function
GO:0030377	urokinase plasminogen activator receptor activity	NAS	molecular function
GO:0030377	urokinase plasminogen activator receptor activity	NAS	molecular function
GO:0031225	anchored component of membrane	IEA	cellular component
GO:0038195	urokinase plasminogen activator signaling pathway	IEA	biological process
GO:0038195	urokinase plasminogen activator signaling pathway	IBA	biological process
GO:0042730	fibrinolysis	TAS	biological process
GO:0042995	cell projection	IEA	cellular component
GO:0043066	negative regulation of apoptotic process	IMP	biological process
GO:0043388	positive regulation of DNA binding	IDA	biological process
GO:0045742	positive regulation of epidermal growth factor receptor signaling pathway	IMP	biological process
GO:0070062	extracellular exosome	IDA	cellular component
GO:0071438	invadopodium membrane	IEA	cellular component
GO:0090200	positive regulation of release of cytochrome c from mitochondria	IMP	biological process
GO:2001243	negative regulation of intrinsic apoptotic signaling pathway	IMP	biological process
GO:2001268	negative regulation of cysteine-type endopeptidase activity involved in apoptotic signaling pathway	IMP	biological process
GO:0001934	positive regulation of protein phosphorylation	IMP	biological process
GO:0004872	receptor activity	TAS	molecular function
GO:0004872	receptor activity	NAS	molecular function
GO:0004872	receptor activity	NAS	molecular function
GO:0005102	receptor binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005788	endoplasmic reticulum lumen	TAS	cellular component
GO:0005789	endoplasmic reticulum membrane	TAS	cellular component
GO:0005789	endoplasmic reticulum membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	IDA	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005925	focal adhesion	IDA	cellular component
GO:0006928	movement of cell or subcellular component	NAS	biological process
GO:0006935	chemotaxis	TAS	biological process
GO:0007165	signal transduction	TAS	biological process
GO:0007596	blood coagulation	TAS	biological process
GO:0007596	blood coagulation	NAS	biological process
GO:0016021	integral component of membrane	NAS	cellular component
GO:0016255	attachment of GPI anchor to protein	TAS	biological process
GO:0019898	extrinsic component of membrane	TAS	cellular component
GO:0019899	enzyme binding	IPI	molecular function
GO:0019904	protein domain specific binding	IPI	molecular function
GO:0030162	regulation of proteolysis	NAS	biological process
GO:0030377	urokinase plasminogen activator receptor activity	IBA	molecular function
GO:0030377	urokinase plasminogen activator receptor activity	NAS	molecular function
GO:0030377	urokinase plasminogen activator receptor activity	NAS	molecular function
GO:0038195	urokinase plasminogen activator signaling pathway	IBA	biological process
GO:0042730	fibrinolysis	TAS	biological process
GO:0043066	negative regulation of apoptotic process	IMP	biological process
GO:0043388	positive regulation of DNA binding	IDA	biological process
GO:0045742	positive regulation of epidermal growth factor receptor signaling pathway	IMP	biological process
GO:0070062	extracellular exosome	IDA	cellular component
GO:0090200	positive regulation of release of cytochrome c from mitochondria	IMP	biological process
GO:2001243	negative regulation of intrinsic apoptotic signaling pathway	IMP	biological process
GO:2001268	negative regulation of cysteine-type endopeptidase activity involved in apoptotic signaling pathway	IMP	biological process

KEGG pathways

Pathway id	Pathway name
hsa00380	Tryptophan metabolism
hsa03410	Base excision repair
hsa04610	Complement and coagulation cascades
hsa05205	Proteoglycans in cancer

Diseases

Associated diseases	References
Cancer (ovarian)	GAD: 20628624
Cancer	GAD: 19117638
Cancer (lung)	GAD: 19117638
Cardiovascular disease	GAD: 20518747
Scleroderma	GAD: 20967855
Asthma	GAD: 19878584
Chronic renal failure	GAD: 21085059
Placenta diseases	GAD: 20447686
Chorioamnionitis	GAD: 20452482
Endometriosis	INFBASE: 14981142
Oligoasthenozoospermia	MIK: 17009528
Oligoasthenozoospermia	MIK: 17009528
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17009528	Oligoasthenozoospermic			66 (22 normospermic males, 44 oligoasthenozoospermia patients)	Male infertility
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)