• Gene id: 5328

Gene Summary

• Gene Symbol: PLAU   Gene   UCSC   Ensembl
• Aliases: ATF, BDPLT5, QPD, UPA, URK, u-PA
• Gene name: plasminogen activator, urokinase
• Alternate names: urokinase-type plasminogen activator, U-plasminogen activator, plasminogen activator, urinary,
• Gene location: 10q22.2 (73909181: 73917500)     Exons: 12     NC_000010.11
• Gene summary(Entrez): This gene encodes a secreted serine protease that converts plasminogen to plasmin. The encoded preproprotein is proteolytically processed to generate A and B polypeptide chains. These chains associate via a single disulfide bond to form the catalytically
• OMIM: 191840

Protein Summary

• Protein general information: P00749  
  • Name: Urokinase type plasminogen activator (U plasminogen activator) (uPA) (EC 3.4.21.73) [Cleaved into: Urokinase type plasminogen activator long chain A; Urokinase type plasminogen activator short chain A; Urokinase type plasminogen activator chain B]
  • Length: 431  
  • Mass: 48,507
• Sequence:

  MRALLARLLLCVLVVSDSKGSNELHQVPSNCDCLNGGTCVSNKYFSNIHWCNCPKKFGGQHCEIDKSKTCYEGNG
  HFYRGKASTDTMGRPCLPWNSATVLQQTYHAHRSDALQLGLGKHNYCRNPDNRRRPWCYVQVGLKPLVQECMVHD
  CADGKKPSSPPEELKFQCGQKTLRPRFKIIGGEFTTIENQPWFAAIYRRHRGGSVTYVCGGSLISPCWVISATHC
  FIDYPKKEDYIVYLGRSRLNSNTQGEMKFEVENLILHKDYSADTLAHHNDIALLKIRSKEGRCAQPSRTIQTICL
  PSMYNDPQFGTSCEITGFGKENSTDYLYPEQLKMTVVKLISHRECQQPHYYGSEVTTKMLCAADPQWKTDSCQGD
  SGGPLVCSLQGRMTLTGIVSWGRGCALKDKPGVYTRVSHFLPWIRSHTKEENGLAL

• Structural information:
  • Protein Domains: EGF-like. (27-63)
    Kringle. (70-151)
    Peptidase (179-424)
  • Interpro: IPR013032  IPR000742  IPR000001  IPR013806  IPR018056   IPR038178  IPR009003  IPR001314  IPR001254  IPR018114  IPR033116  IPR034814  
  • Prosite: PS00022 PS50026 PS00021 PS50070 PS50240 PS00134 PS00135
  • CDD: cd00190
  • PDB: 1C5W 1C5X 1C5Y 1C5Z 1EJN 1F5K 1F5L 1F92 1FV9 1GI7 1GI8 1GI9 1GJ7 1GJ8 1GJ9 1GJA 1GJB 1GJC 1GJD 1KDU 1LMW 1O3P 1O5A 1O5B 1O5C 1OWD 1OWE 1OWH 1OWI 1OWJ 1OWK 1SC8 1SQA 1SQO 1SQT 1U6Q 1URK 1VJ9 1VJA 1W0Z 1W10 1W11 1W12 1W13 1W14 2FD6 2I9A 2I9B 2NWN 2O8T 2O8U
  • PDBsum: 1C5W 1C5X 1C5Y 1C5Z 1EJN 1F5K 1F5L 1F92 1FV9 1GI7 1GI8 1GI9 1GJ7 1GJ8 1GJ9 1GJA 1GJB 1GJC 1GJD 1KDU 1LMW 1O3P 1O5A 1O5B 1O5C 1OWD 1OWE 1OWH 1OWI 1OWJ 1OWK 1SC8 1SQA 1SQO 1SQT 1U6Q 1URK 1VJ9 1VJA 1W0Z 1W10 1W11 1W12 1W13 1W14 2FD6 2I9A 2I9B 2NWN 2O8T 2O8U
  • DIP: 46387
  • STRING: ENSP00000361850
• Other Databases: GeneCards:  PLAU  Malacards:  PLAU

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0001525	angiogenesis	IEA	biological process
GO:0004252	serine-type endopeptidase activity	IBA	molecular function
GO:0004252	serine-type endopeptidase activity	TAS	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005576	extracellular region	TAS	cellular component
GO:0005615	extracellular space	IDA	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005925	focal adhesion	IDA	cellular component
GO:0006508	proteolysis	IEA	biological process
GO:0006935	chemotaxis	TAS	biological process
GO:0007165	signal transduction	TAS	biological process
GO:0007283	spermatogenesis	IEA	biological process
GO:0007566	embryo implantation	IEA	biological process
GO:0007596	blood coagulation	IEA	biological process
GO:0008284	positive regulation of cell proliferation	IEA	biological process
GO:0009986	cell surface	IDA	cellular component
GO:0010469	regulation of receptor activity	IDA	biological process
GO:0014823	response to activity	IEA	biological process
GO:0014909	smooth muscle cell migration	IEA	biological process
GO:0014910	regulation of smooth muscle cell migration	IDA	biological process
GO:0014911	positive regulation of smooth muscle cell migration	IEA	biological process
GO:0030335	positive regulation of cell migration	IDA	biological process
GO:0033628	regulation of cell adhesion mediated by integrin	IDA	biological process
GO:0035729	cellular response to hepatocyte growth factor stimulus	IEA	biological process
GO:0042730	fibrinolysis	TAS	biological process
GO:0043403	skeletal muscle tissue regeneration	IEA	biological process
GO:0055093	response to hyperoxia	IEA	biological process
GO:0060279	positive regulation of ovulation	IEA	biological process
GO:0061041	regulation of wound healing	IC	biological process
GO:0070062	extracellular exosome	IDA	cellular component
GO:0070062	extracellular exosome	IDA	cellular component
GO:0070997	neuron death	IEA	biological process
GO:0071222	cellular response to lipopolysaccharide	IEA	biological process
GO:0071333	cellular response to glucose stimulus	IEA	biological process
GO:0071456	cellular response to hypoxia	IEA	biological process
GO:0071498	cellular response to fluid shear stress	IEA	biological process
GO:0072734	cellular response to staurosporine	IEA	biological process
GO:2000097	regulation of smooth muscle cell-matrix adhesion	IDA	biological process
GO:2000345	regulation of hepatocyte proliferation	IEA	biological process
GO:2000379	positive regulation of reactive oxygen species metabolic process	IEA	biological process
GO:0001525	angiogenesis	IEA	biological process
GO:0001666	response to hypoxia	IEA	biological process
GO:0004252	serine-type endopeptidase activity	IEA	molecular function
GO:0004252	serine-type endopeptidase activity	IBA	molecular function
GO:0004252	serine-type endopeptidase activity	TAS	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005576	extracellular region	IEA	cellular component
GO:0005576	extracellular region	IEA	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005615	extracellular space	IEA	cellular component
GO:0005615	extracellular space	IDA	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005925	focal adhesion	IDA	cellular component
GO:0006508	proteolysis	IEA	biological process
GO:0006508	proteolysis	IEA	biological process
GO:0006508	proteolysis	TAS	biological process
GO:0006935	chemotaxis	TAS	biological process
GO:0007165	signal transduction	TAS	biological process
GO:0007283	spermatogenesis	IEA	biological process
GO:0007566	embryo implantation	IEA	biological process
GO:0007596	blood coagulation	IEA	biological process
GO:0007599	hemostasis	IEA	biological process
GO:0008233	peptidase activity	IEA	molecular function
GO:0008233	peptidase activity	IEA	molecular function
GO:0008236	serine-type peptidase activity	IEA	molecular function
GO:0008284	positive regulation of cell proliferation	IEA	biological process
GO:0009986	cell surface	IDA	cellular component
GO:0010469	regulation of receptor activity	IDA	biological process
GO:0014823	response to activity	IEA	biological process
GO:0014909	smooth muscle cell migration	IEA	biological process
GO:0014910	regulation of smooth muscle cell migration	IDA	biological process
GO:0014911	positive regulation of smooth muscle cell migration	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0016787	hydrolase activity	IEA	molecular function
GO:0030335	positive regulation of cell migration	IDA	biological process
GO:0033628	regulation of cell adhesion mediated by integrin	IDA	biological process
GO:0035728	response to hepatocyte growth factor	IEA	biological process
GO:0035729	cellular response to hepatocyte growth factor stimulus	IEA	biological process
GO:0042060	wound healing	IEA	biological process
GO:0042127	regulation of cell proliferation	IEA	biological process
GO:0042730	fibrinolysis	IEA	biological process
GO:0042730	fibrinolysis	IEA	biological process
GO:0042730	fibrinolysis	TAS	biological process
GO:0043403	skeletal muscle tissue regeneration	IEA	biological process
GO:0055093	response to hyperoxia	IEA	biological process
GO:0060279	positive regulation of ovulation	IEA	biological process
GO:0061041	regulation of wound healing	IC	biological process
GO:0070062	extracellular exosome	IDA	cellular component
GO:0070062	extracellular exosome	IDA	cellular component
GO:0070997	neuron death	IEA	biological process
GO:0071222	cellular response to lipopolysaccharide	IEA	biological process
GO:0071310	cellular response to organic substance	IEA	biological process
GO:0071333	cellular response to glucose stimulus	IEA	biological process
GO:0071456	cellular response to hypoxia	IEA	biological process
GO:0071498	cellular response to fluid shear stress	IEA	biological process
GO:0072734	cellular response to staurosporine	IEA	biological process
GO:2000097	regulation of smooth muscle cell-matrix adhesion	IDA	biological process
GO:2000345	regulation of hepatocyte proliferation	IEA	biological process
GO:2000379	positive regulation of reactive oxygen species metabolic process	IEA	biological process
GO:0004252	serine-type endopeptidase activity	IBA	molecular function
GO:0004252	serine-type endopeptidase activity	TAS	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005576	extracellular region	TAS	cellular component
GO:0005615	extracellular space	IDA	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005925	focal adhesion	IDA	cellular component
GO:0006508	proteolysis	TAS	biological process
GO:0006935	chemotaxis	TAS	biological process
GO:0007165	signal transduction	TAS	biological process
GO:0009986	cell surface	IDA	cellular component
GO:0010469	regulation of receptor activity	IDA	biological process
GO:0014910	regulation of smooth muscle cell migration	IDA	biological process
GO:0030335	positive regulation of cell migration	IDA	biological process
GO:0033628	regulation of cell adhesion mediated by integrin	IDA	biological process
GO:0042730	fibrinolysis	TAS	biological process
GO:0061041	regulation of wound healing	IC	biological process
GO:0070062	extracellular exosome	IDA	cellular component
GO:0070062	extracellular exosome	IDA	cellular component
GO:2000097	regulation of smooth muscle cell-matrix adhesion	IDA	biological process

KEGG pathways

Pathway id	Pathway name
hsa00562	Inositol phosphate metabolism
hsa00380	Tryptophan metabolism
hsa03018	RNA degradation
hsa03018	RNA degradation
hsa03410	Base excision repair
hsa04014	Ras signaling pathway
hsa04610	Complement and coagulation cascades
hsa05202	Transcriptional misregulation in cancer
hsa05206	MicroRNAs in cancer
hsa05205	Proteoglycans in cancer
hsa05215	Prostate cancer

Diseases

Associated diseases	References
Cancer (colorectal)	GAD: 11876553
Cancer (lung)	GAD: 19117638
Cancer (oral)	GAD: 15356878
Cancer (ovarian)	GAD: 20628624
Cancer	GAD: 19526059
Cancer (bladder)	GAD: 16825821
Cancer (prostate)	GAD: 17192053
Cancer (thyroid)	GAD: 19730683
Cardiovascular disease	GAD: 20518747
Bronchopulmonary dysplasia	GAD: 15868845
Quebec platelet disorder	GAD: 20007542
Rheumatoid arthritis	GAD: 15083890
Multiple sclerosis	GAD: 17986506
Asthma	GAD: 17363771
Diabetes	GAD: 15750768
Bone diseases	GAD: 17559626
Alzheimer's disease	OMIM: 191840
Chronic renal failure	GAD: 21085059
Polycystic ovary syndrome (PCOS)	GAD: 17661167
Endometriosis	INFBASE: 19945964
Implantation failure	INFBASE: 16274610
Oligoasthenoteratozoospermia	MIK: 1908531
Azoospermia	MIK: 1908531
Chronic prostatitis	MIK: 15362519
Oligoasthenozoospermia	MIK: 17009528
Sperm motility	MIK: 9812782
Chorioamnionitis	GAD: 20452482
Endometriosis	INFBASE: 9806560
Nephrolithiasis	GAD: 16509805
Urolithiasis	GAD: 11880102
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Azoospermia	MIK: 1908531
Chronic prostatitis	MIK: 15362519
Male infertility	MIK: 29631885
Oligoasthenoteratozoospermia (OAT-syndrome)	MIK: 1908531
Sperm motility	MIK: 9812782
Spermatogenic defects	MIK: 17434507
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17009528	Oligoasthenozoospermia, male infertility			66 (22 normospermic males, 44 oligoasthenozoospermia)	Male infertility
15999481	Sperm motility, Male infertiltiy				Male infertility
15362519	Chronic prostatitis			103 (23 fertile males, 80 chronic prostatitis patients (40 fertile and 40 infertile))	Male infertility
1908531	Azoospermia, oligoasthenoteratozoospermia (OAT-syndrome)			67 (15 patients showed normozoospermia, 11 azoospermia, 41 oligoasthenoteratozoospermia (OAT-syndrome))	Male infertility	u-PA t-PA PAI
9812782	Sperm motility, fertility			42 (22 infertile patients with asthenospermia, 20 healthy fertile men)	Male infertility	uPA
17434507	Spermatogenic defects				Male infertility
2515818	Male subfertility				Male infertility
29631885	Male infertility				Male infertility
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
31037746	Spermatogenic defects			16 (1 control, 15 cases)	Male infertility	GSE6023 analyzed using GEO2R