• Gene id: 5327

Gene Summary

• Gene Symbol: PLAT   Gene   UCSC   Ensembl
• Aliases: T-PA, TPA
• Gene name: plasminogen activator, tissue type
• Alternate names: tissue-type plasminogen activator, alteplase, plasminogen/activator kringle, reteplase, t-plasminogen activator,
• Gene location: 8p11.21 (42207723: 42174717)     Exons: 14     NC_000008.11
• Gene summary(Entrez): This gene encodes tissue-type plasminogen activator, a secreted serine protease that converts the proenzyme plasminogen to plasmin, a fibrinolytic enzyme. The encoded preproprotein is proteolytically processed by plasmin or trypsin to generate heavy and l
• OMIM: 173370

SNPs

rs11754464

Strand:    Allele origin:   Allele change:   Mutation type: snv

NC_000006.12   g.31755958C>T
NC_000006.11   g.31723735C>T
NG_011611.1   g.20962C>T
NT_113891.3   g.3233215C>T
NT_113891.2   g.3233321C>T
NT_167245.2   g.3003732C>T
NT_167245.1   g.3009317C>T
NT_167247.2   g.3097847C>T
NT_167247.1   g.3103432C>T
NT_167248.2   g.3011780C>

Protein Summary

• Protein general information: P00750  
  • Name: Tissue type plasminogen activator (t PA) (t plasminogen activator) (tPA) (EC 3.4.21.68) (Alteplase) (Reteplase) [Cleaved into: Tissue type plasminogen activator chain A; Tissue type plasminogen activator chain B]
  • Length: 562  
  • Mass: 62,917
• Sequence:

  MDAMKRGLCCVLLLCGAVFVSPSQEIHARFRRGARSYQVICRDEKTQMIYQQHQSWLRPVLRSNRVEYCWCNSGR
  AQCHSVPVKSCSEPRCFNGGTCQQALYFSDFVCQCPEGFAGKCCEIDTRATCYEDQGISYRGTWSTAESGAECTN
  WNSSALAQKPYSGRRPDAIRLGLGNHNYCRNPDRDSKPWCYVFKAGKYSSEFCSTPACSEGNSDCYFGNGSAYRG
  THSLTESGASCLPWNSMILIGKVYTAQNPSAQALGLGKHNYCRNPDGDAKPWCHVLKNRRLTWEYCDVPSCSTCG
  LRQYSQPQFRIKGGLFADIASHPWQAAIFAKHRRSPGERFLCGGILISSCWILSAAHCFQERFPPHHLTVILGRT
  YRVVPGEEEQKFEVEKYIVHKEFDDDTYDNDIALLQLKSDSSRCAQESSVVRTVCLPPADLQLPDWTECELSGYG
  KHEALSPFYSERLKEAHVRLYPSSRCTSQHLLNRTVTDNMLCAGDTRSGGPQANLHDACQGDSGGPLVCLNDGRM
  TLVGIISWGLGCGQKDVPGVYTKVTNYLDWIRDNMRP

• Structural information:
  • Protein Domains: Fibronectin (39-81)
    EGF-like. (82-120)
    Kringle (127-208)
    Kringle (215-296)
  • Interpro: IPR013032  IPR000742  IPR000083  IPR000001  IPR013806   IPR018056  IPR038178  IPR009003  IPR001314  IPR026280  IPR034811  IPR001254  IPR018114  IPR033116  
  • Prosite: PS00022 PS01186 PS50026 PS01253 PS51091 PS00021 PS50070 PS50240 PS00134 PS00135
  • CDD: cd00190
  • PDB: 1A5H 1BDA 1PK2 1PML 1RTF 1TPG 1TPK 1TPM 1TPN 5BRR
  • PDBsum: 1A5H 1BDA 1PK2 1PML 1RTF 1TPG 1TPK 1TPM 1TPN 5BRR
  • STRING: ENSP00000220809
• Other Databases: GeneCards:  PLAT  Malacards:  PLAT

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0001666	response to hypoxia	IEA	biological process
GO:0001948	glycoprotein binding	TAS	molecular function
GO:0004252	serine-type endopeptidase activity	IDA	molecular function
GO:0004252	serine-type endopeptidase activity	IDA	molecular function
GO:0004252	serine-type endopeptidase activity	TAS	molecular function
GO:0004252	serine-type endopeptidase activity	TAS	molecular function
GO:0005102	receptor binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005615	extracellular space	IEA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0006464	cellular protein modification process	TAS	biological process
GO:0006508	proteolysis	TAS	biological process
GO:0007596	blood coagulation	TAS	biological process
GO:0009986	cell surface	IDA	cellular component
GO:0014909	smooth muscle cell migration	IEA	biological process
GO:0030141	secretory granule	IEA	cellular component
GO:0031639	plasminogen activation	IDA	biological process
GO:0042730	fibrinolysis	TAS	biological process
GO:0045177	apical part of cell	IEA	cellular component
GO:0045861	negative regulation of proteolysis	IDA	biological process
GO:0048008	platelet-derived growth factor receptor signaling pathway	IEA	biological process
GO:0051219	phosphoprotein binding	IPI	molecular function
GO:0070062	extracellular exosome	IDA	cellular component
GO:0070062	extracellular exosome	IDA	cellular component
GO:0031012	extracellular matrix	IDA	cellular component
GO:0001666	response to hypoxia	IEA	biological process
GO:0001948	glycoprotein binding	TAS	molecular function
GO:0004252	serine-type endopeptidase activity	IEA	molecular function
GO:0004252	serine-type endopeptidase activity	IEA	molecular function
GO:0004252	serine-type endopeptidase activity	IDA	molecular function
GO:0004252	serine-type endopeptidase activity	IDA	molecular function
GO:0004252	serine-type endopeptidase activity	TAS	molecular function
GO:0004252	serine-type endopeptidase activity	TAS	molecular function
GO:0005102	receptor binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005576	extracellular region	IEA	cellular component
GO:0005576	extracellular region	IEA	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005615	extracellular space	IEA	cellular component
GO:0005615	extracellular space	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0006464	cellular protein modification process	TAS	biological process
GO:0006508	proteolysis	IEA	biological process
GO:0006508	proteolysis	IEA	biological process
GO:0006508	proteolysis	IEA	biological process
GO:0006508	proteolysis	TAS	biological process
GO:0007596	blood coagulation	TAS	biological process
GO:0008233	peptidase activity	IEA	molecular function
GO:0008236	serine-type peptidase activity	IEA	molecular function
GO:0009986	cell surface	IDA	cellular component
GO:0014909	smooth muscle cell migration	IEA	biological process
GO:0016787	hydrolase activity	IEA	molecular function
GO:0030141	secretory granule	IEA	cellular component
GO:0031639	plasminogen activation	IEA	biological process
GO:0031639	plasminogen activation	IDA	biological process
GO:0042730	fibrinolysis	TAS	biological process
GO:0045177	apical part of cell	IEA	cellular component
GO:0045861	negative regulation of proteolysis	IDA	biological process
GO:0048008	platelet-derived growth factor receptor signaling pathway	IEA	biological process
GO:0051219	phosphoprotein binding	IPI	molecular function
GO:0070062	extracellular exosome	IDA	cellular component
GO:0070062	extracellular exosome	IDA	cellular component
GO:0031012	extracellular matrix	IDA	cellular component
GO:0001948	glycoprotein binding	TAS	molecular function
GO:0004252	serine-type endopeptidase activity	IDA	molecular function
GO:0004252	serine-type endopeptidase activity	IDA	molecular function
GO:0004252	serine-type endopeptidase activity	TAS	molecular function
GO:0004252	serine-type endopeptidase activity	TAS	molecular function
GO:0005102	receptor binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0006464	cellular protein modification process	TAS	biological process
GO:0006508	proteolysis	TAS	biological process
GO:0007596	blood coagulation	TAS	biological process
GO:0009986	cell surface	IDA	cellular component
GO:0031639	plasminogen activation	IDA	biological process
GO:0042730	fibrinolysis	TAS	biological process
GO:0045861	negative regulation of proteolysis	IDA	biological process
GO:0051219	phosphoprotein binding	IPI	molecular function
GO:0070062	extracellular exosome	IDA	cellular component
GO:0070062	extracellular exosome	IDA	cellular component
GO:0031012	extracellular matrix	IDA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa00640	Propanoate metabolism
hsa00380	Tryptophan metabolism
hsa03018	RNA degradation
hsa04014	Ras signaling pathway
hsa04010	MAPK signaling pathway
hsa04610	Complement and coagulation cascades
hsa05202	Transcriptional misregulation in cancer
hsa05215	Prostate cancer
hsa05418	Fluid shear stress and atherosclerosis

Diseases

Associated diseases	References
Gastric ulcer	GAD: 12589088
Cancer	GAD: 19730683
Cancer (ovarian)	GAD: 20628624
Cancer (thyroid)	GAD: 19730683
Aneurysm	GAD: 19061349
Atherosclerosis	GAD: 16248996
Brain ischemia	GAD: 18622144
Cardiovascular disease	GAD: 11963567
Hypertension	GAD: 12484521
Thromboembolism	GAD: 15976969
Thrombosis	GAD: 20508517
Venous thromboembolism	GAD: 18449420
Rheumatoid arthritis	GAD: 16356191
Inflammatory bowel disease	GAD: 11771311
Periodontitis	GAD: 17257155
Stroke	GAD: 12468767
Alzheimer's disease	GAD: 16828203
Cerebral palsy	GAD: 18977990
Hearing Loss	GAD: 15109703
Psychological disorders	GAD: 15542697
Chronic renal failure	GAD: 21085059
Kidney diseases	GAD: 19578796
Placenta diseases	GAD: 20447686
Endometriosis	INFBASE: 7805923
Polycystic ovary syndrome (PCOS)	INFBASE: 12107238
Polycystic ovary syndrome (PCOS)	INFBASE: 17661167
Oligoasthenoteratozoospermia	MIK: 1908531
Oligozoospermia	MIK: 8150119
Oligozoospermia	MIK: 8150119
Asthenozoospermia	MIK: 8150119
Azoospermia	MIK: 1908531
Chorioamnionitis	GAD: 20452482
Asthenozoospermia	MIK: 8150119
Connective tissue diseases	GAD: 19527514
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Azoospermia	MIK: 1908531
Oligoasthenoteratozoospermia (OAT-syndrome)	MIK: 1908531
Oligozoospermia	MIK: 8150119
Spermatogenic defects	MIK: 17434507

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
1908531	Azoospermia, oligoasthenoteratozoospermia (OAT-syndrome)			67 (15 patients showed normozoospermia, 11 azoospermia, 41 oligoasthenoteratozoospermia (OAT-syndrome))	Male infertility	u-PA t-PA PAI
8150119	Oligozoospermia, asthenozoospermia			92 men attending for assessment because of infertility	Male infertility	tPA
17434507	Spermatogenic defects				Male infertility
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881