• Gene id: 5322

Gene Summary

• Gene Symbol: PLA2G5   Gene   UCSC   Ensembl
• Aliases: FRFB, GV-PLA2, PLA2-10, hVPLA(2)
• Gene name: phospholipase A2 group V
• Alternate names: calcium-dependent phospholipase A2, Ca2+-dependent phospholipase A2, phosphatidylcholine 2-acylhydrolase 5,
• Gene location: 1p36.13 (20028348: 20091910)     Exons: 13     NC_000001.11
• Gene summary(Entrez): This gene is a member of the secretory phospholipase A2 family. It is located in a tightly-linked cluster of secretory phospholipase A2 genes on chromosome 1. The encoded enzyme catalyzes the hydrolysis of membrane phospholipids to generate lysophospholip
• OMIM: 125645

Protein Summary

• Protein general information: P39877  
  • Name: Calcium dependent phospholipase A2 (EC 3.1.1.4) (Group V phospholipase A2) (PLA2 10) (Phosphatidylcholine 2 acylhydrolase 5)
  • Length: 138  
  • Mass: 15674
  • Tissue specificity: Heart, placenta and less abundantly, in lung. Detected in the outer and inner plexiform layers of the retina (at protein level). {ECO
• Sequence:

  MKGLLPLAWFLACSVPAVQGGLLDLKSMIEKVTGKNALTNYGFYGCYCGWGGRGTPKDGTDWCCWAHDHCYGRLE
  EKGCNIRTQSYKYRFAWGVVTCEPGPFCHVNLCACDRKLVYCLKRNLRSYNPQYQYFPNILCS

• Structural information:
  • Interpro: IPR001211  IPR033112  IPR016090  IPR036444  IPR033113  
  • Prosite: PS00119 PS00118
  • CDD: cd00125
  • PDB: 2GHN
  • PDBsum: 2GHN
  • STRING: ENSP00000364249
• Other Databases: GeneCards:  PLA2G5  Malacards:  PLA2G5

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0070374	positive regulation of ERK1 and ERK2 cascade	IDA	biological process
GO:0010518	positive regulation of phospholipase activity	IDA	biological process
GO:0006644	phospholipid metabolic process	IBA	biological process
GO:0005509	calcium ion binding	IBA	molecular function
GO:0050482	arachidonic acid secretion	IBA	biological process
GO:0047498	calcium-dependent phospholipase A2 activity	IBA	molecular function
GO:0005543	phospholipid binding	IBA	molecular function
GO:0004623	phospholipase A2 activity	IBA	molecular function
GO:0035965	cardiolipin acyl-chain remodeling	IDA	biological process
GO:0034638	phosphatidylcholine catabolic process	IDA	biological process
GO:0047499	calcium-independent phospholipase A2 activity	IDA	molecular function
GO:0019370	leukotriene biosynthetic process	IDA	biological process
GO:0090265	positive regulation of immune complex clearance by monocytes and macrophages	IDA	biological process
GO:0010744	positive regulation of macrophage derived foam cell differentiation	ISS	biological process
GO:1905036	positive regulation of antifungal innate immune response	ISS	biological process
GO:0032010	phagolysosome	ISS	cellular component
GO:0032009	early phagosome	ISS	cellular component
GO:0034374	low-density lipoprotein particle remodeling	ISS	biological process
GO:1905164	positive regulation of phagosome maturation	ISS	biological process
GO:1903028	positive regulation of opsonization	ISS	biological process
GO:0090385	phagosome-lysosome fusion	ISS	biological process
GO:0050766	positive regulation of phagocytosis	ISS	biological process
GO:0005509	calcium ion binding	IEA	molecular function
GO:0006644	phospholipid metabolic process	IEA	biological process
GO:0004623	phospholipase A2 activity	IEA	molecular function
GO:0016042	lipid catabolic process	IEA	biological process
GO:0050482	arachidonic acid secretion	IEA	biological process
GO:0005794	Golgi apparatus	IEA	cellular component
GO:0005576	extracellular region	IEA	cellular component
GO:0016787	hydrolase activity	IEA	molecular function
GO:0046872	metal ion binding	IEA	molecular function
GO:0031410	cytoplasmic vesicle	IEA	cellular component
GO:0009395	phospholipid catabolic process	IEA	biological process
GO:0005768	endosome	IEA	cellular component
GO:0006909	phagocytosis	IEA	biological process
GO:0006631	fatty acid metabolic process	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0016042	lipid catabolic process	IEA	biological process
GO:0005886	plasma membrane	IEA	cellular component
GO:0006629	lipid metabolic process	IEA	biological process
GO:0047498	calcium-dependent phospholipase A2 activity	TAS	molecular function
GO:0005576	extracellular region	TAS	cellular component
GO:0006644	phospholipid metabolic process	TAS	biological process
GO:0102567	phospholipase A2 activity (consuming 1,2-dipalmitoylphosphatidylcholine)	IEA	molecular function
GO:0004623	phospholipase A2 activity	IEA	molecular function
GO:0102568	phospholipase A2 activity consuming 1,2-dioleoylphosphatidylethanolamine)	IEA	molecular function
GO:0036148	phosphatidylglycerol acyl-chain remodeling	TAS	biological process
GO:0036149	phosphatidylinositol acyl-chain remodeling	TAS	biological process
GO:0036150	phosphatidylserine acyl-chain remodeling	TAS	biological process
GO:0036152	phosphatidylethanolamine acyl-chain remodeling	TAS	biological process
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0006654	phosphatidic acid biosynthetic process	TAS	biological process
GO:0036151	phosphatidylcholine acyl-chain remodeling	TAS	biological process
GO:0005794	Golgi apparatus	IEA	cellular component
GO:0034097	response to cytokine	IEA	biological process
GO:0048471	perinuclear region of cytoplasm	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0006663	platelet activating factor biosynthetic process	IEA	biological process
GO:0008201	heparin binding	IEA	molecular function
GO:0019370	leukotriene biosynthetic process	IEA	biological process
GO:0047498	calcium-dependent phospholipase A2 activity	IEA	molecular function
GO:0050482	arachidonic acid secretion	IEA	biological process
GO:0051591	response to cAMP	IEA	biological process
GO:0005886	plasma membrane	IEA	cellular component
GO:0045335	phagocytic vesicle	IEA	cellular component
GO:0005794	Golgi apparatus	IEA	cellular component
GO:0055037	recycling endosome	IEA	cellular component
GO:0005576	extracellular region	IEA	cellular component
GO:0006644	phospholipid metabolic process	IEA	biological process

KEGG pathways

Pathway id	Pathway name
hsa01100	Metabolic pathways
hsa04014	Ras signaling pathway
hsa04270	Vascular smooth muscle contraction
hsa00564	Glycerophospholipid metabolism
hsa04972	Pancreatic secretion
hsa00590	Arachidonic acid metabolism
hsa00565	Ether lipid metabolism
hsa04975	Fat digestion and absorption
hsa00591	Linoleic acid metabolism
hsa00592	alpha-Linolenic acid metabolism

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881