• Gene id: 5321

Gene Summary

• Gene Symbol: PLA2G4A   Gene   UCSC   Ensembl
• Aliases: GURDP, PLA2G4, cPLA2, cPLA2-alpha
• Gene name: phospholipase A2 group IVA
• Alternate names: cytosolic phospholipase A2, calcium-dependent phospholipid-binding protein, lysophospholipase, phosphatidylcholine 2-acylhydrolase, phospholipase A2, group IVA (cytosolic, calcium-dependent),
• Gene location: 1q31.1 (186828948: 186988980)     Exons: 19     NC_000001.11
• Gene summary(Entrez): This gene encodes a member of the cytosolic phospholipase A2 group IV family. The enzyme catalyzes the hydrolysis of membrane phospholipids to release arachidonic acid which is subsequently metabolized into eicosanoids. Eicosanoids, including prostaglandi
• OMIM: 600522

Protein Summary

• Protein general information: P47712  
  • Name: Cytosolic phospholipase A2 (cPLA2) (Phospholipase A2 group IVA) [Includes: Phospholipase A2 (EC 3.1.1.4) (Phosphatidylcholine 2 acylhydrolase); Lysophospholipase (EC 3.1.1.5)]
  • Length: 749  
  • Mass: 85239
  • Tissue specificity: Expressed in various cells and tissues such as macrophages, neutrophils, fibroblasts and lung endothelium. Expressed in platelets (at protein level) (PubMed
• Sequence:

  MSFIDPYQHIIVEHQYSHKFTVVVLRATKVTKGAFGDMLDTPDPYVELFISTTPDSRKRTRHFNNDINPVWNETF
  EFILDPNQENVLEITLMDANYVMDETLGTATFTVSSMKVGEKKEVPFIFNQVTEMVLEMSLEVCSCPDLRFSMAL
  CDQEKTFRQQRKEHIRESMKKLLGPKNSEGLHSARDVPVVAILGSGGGFRAMVGFSGVMKALYESGILDCATYVA
  GLSGSTWYMSTLYSHPDFPEKGPEEINEELMKNVSHNPLLLLTPQKVKRYVESLWKKKSSGQPVTFTDIFGMLIG
  ETLIHNRMNTTLSSLKEKVNTAQCPLPLFTCLHVKPDVSELMFADWVEFSPYEIGMAKYGTFMAPDLFGSKFFMG
  TVVKKYEENPLHFLMGVWGSAFSILFNRVLGVSGSQSRGSTMEEELENITTKHIVSNDSSDSDDESHEPKGTENE
  DAGSDYQSDNQASWIHRMIMALVSDSALFNTREGRAGKVHNFMLGLNLNTSYPLSPLSDFATQDSFDDDELDAAV
  ADPDEFERIYEPLDVKSKKIHVVDSGLTFNLPYPLILRPQRGVDLIISFDFSARPSDSSPPFKELLLAEKWAKMN
  KLPFPKIDPYVFDREGLKECYVFKPKNPDMEKDCPTIIHFVLANINFRKYRAPGVPRETEEEKEIADFDIFDDPE
  SPFSTFNFQYPNQAFKRLHDLMHFNTLNNIDVIKEAMVESIEYRRQNPSRCSVSLSNVEARRFFNKEFLSKPKA

• Structural information:
  • Protein Domains: (6..12-)
    (/note="C2-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00041-)
    (140..74-)
    (/note="PLA2c-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00555"-)
  • Interpro: IPR016035  IPR041847  IPR000008  IPR035892  IPR002642  
  • Prosite: PS50004 PS51210
  • CDD: cd04036
  • PDB: 1BCI 1CJY 1RLW
  • PDBsum: 1BCI 1CJY 1RLW
  • DIP: 40991
  • STRING: ENSP00000356436
• Other Databases: GeneCards:  PLA2G4A  Malacards:  PLA2G4A

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0004623	phospholipase A2 activity	IBA	molecular function
GO:0005634	nucleus	IBA	cellular component
GO:0046475	glycerophospholipid catabolic process	IBA	biological process
GO:0047498	calcium-dependent phospholipase A2 activity	IBA	molecular function
GO:0005509	calcium ion binding	IBA	molecular function
GO:0005544	calcium-dependent phospholipid binding	IBA	molecular function
GO:0005783	endoplasmic reticulum	IBA	cellular component
GO:0005794	Golgi apparatus	IBA	cellular component
GO:0005829	cytosol	IBA	cellular component
GO:0005544	calcium-dependent phospholipid binding	IDA	molecular function
GO:0005509	calcium ion binding	IDA	molecular function
GO:0005509	calcium ion binding	IDA	molecular function
GO:0004623	phospholipase A2 activity	IDA	molecular function
GO:1902387	ceramide 1-phosphate binding	IDA	molecular function
GO:0034478	phosphatidylglycerol catabolic process	IDA	biological process
GO:0008374	O-acyltransferase activity	IDA	molecular function
GO:0004622	lysophospholipase activity	IDA	molecular function
GO:0000139	Golgi membrane	IDA	cellular component
GO:0010314	phosphatidylinositol-5-phosphate binding	IDA	molecular function
GO:0070273	phosphatidylinositol-4-phosphate binding	IDA	molecular function
GO:0004622	lysophospholipase activity	IDA	molecular function
GO:0004622	lysophospholipase activity	IDA	molecular function
GO:0034638	phosphatidylcholine catabolic process	IDA	biological process
GO:0047498	calcium-dependent phospholipase A2 activity	IDA	molecular function
GO:0034638	phosphatidylcholine catabolic process	IDA	biological process
GO:0047498	calcium-dependent phospholipase A2 activity	IDA	molecular function
GO:0006640	monoacylglycerol biosynthetic process	IDA	biological process
GO:0034638	phosphatidylcholine catabolic process	IDA	biological process
GO:0019369	arachidonic acid metabolic process	IDA	biological process
GO:0047498	calcium-dependent phospholipase A2 activity	IDA	molecular function
GO:0034638	phosphatidylcholine catabolic process	IDA	biological process
GO:0047498	calcium-dependent phospholipase A2 activity	IDA	molecular function
GO:0034638	phosphatidylcholine catabolic process	IDA	biological process
GO:0047498	calcium-dependent phospholipase A2 activity	IDA	molecular function
GO:0005635	nuclear envelope	IDA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0034638	phosphatidylcholine catabolic process	IDA	biological process
GO:0032266	phosphatidylinositol-3-phosphate binding	IDA	molecular function
GO:0047499	calcium-independent phospholipase A2 activity	IDA	molecular function
GO:0001516	prostaglandin biosynthetic process	IDA	biological process
GO:0010572	positive regulation of platelet activation	IMP	biological process
GO:0001516	prostaglandin biosynthetic process	IMP	biological process
GO:0019370	leukotriene biosynthetic process	IMP	biological process
GO:0047498	calcium-dependent phospholipase A2 activity	IMP	molecular function
GO:0004620	phospholipase activity	IEA	molecular function
GO:0005509	calcium ion binding	IEA	molecular function
GO:0009395	phospholipid catabolic process	IEA	biological process
GO:0005794	Golgi apparatus	IEA	cellular component
GO:0006633	fatty acid biosynthetic process	IEA	biological process
GO:0008289	lipid binding	IEA	molecular function
GO:0006693	prostaglandin metabolic process	IEA	biological process
GO:0016787	hydrolase activity	IEA	molecular function
GO:0006071	glycerol metabolic process	IEA	biological process
GO:0046872	metal ion binding	IEA	molecular function
GO:0009395	phospholipid catabolic process	IEA	biological process
GO:0016042	lipid catabolic process	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0006629	lipid metabolic process	IEA	biological process
GO:0001516	prostaglandin biosynthetic process	IEA	biological process
GO:0019370	leukotriene biosynthetic process	IEA	biological process
GO:0006631	fatty acid metabolic process	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0102568	phospholipase A2 activity consuming 1,2-dioleoylphosphatidylethanolamine)	IEA	molecular function
GO:0004623	phospholipase A2 activity	IEA	molecular function
GO:0102567	phospholipase A2 activity (consuming 1,2-dipalmitoylphosphatidylcholine)	IEA	molecular function
GO:0102545	phosphatidyl phospholipase B activity	IEA	molecular function
GO:0004622	lysophospholipase activity	IEA	molecular function
GO:0005743	mitochondrial inner membrane	TAS	cellular component
GO:0019369	arachidonic acid metabolic process	TAS	biological process
GO:0036148	phosphatidylglycerol acyl-chain remodeling	TAS	biological process
GO:0036149	phosphatidylinositol acyl-chain remodeling	TAS	biological process
GO:0036150	phosphatidylserine acyl-chain remodeling	TAS	biological process
GO:0036152	phosphatidylethanolamine acyl-chain remodeling	TAS	biological process
GO:0005789	endoplasmic reticulum membrane	TAS	cellular component
GO:0005789	endoplasmic reticulum membrane	TAS	cellular component
GO:0005789	endoplasmic reticulum membrane	TAS	cellular component
GO:0005789	endoplasmic reticulum membrane	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0006644	phospholipid metabolic process	TAS	biological process
GO:0006654	phosphatidic acid biosynthetic process	TAS	biological process
GO:0035965	cardiolipin acyl-chain remodeling	TAS	biological process
GO:0036151	phosphatidylcholine acyl-chain remodeling	TAS	biological process
GO:0042127	regulation of cell population proliferation	IEA	biological process
GO:0005829	cytosol	IEA	cellular component
GO:0005794	Golgi apparatus	IEA	cellular component
GO:0005783	endoplasmic reticulum	IEA	cellular component
GO:0002827	positive regulation of T-helper 1 type immune response	IEA	biological process
GO:0071236	cellular response to antibiotic	IEA	biological process
GO:0050482	arachidonic acid secretion	IEA	biological process
GO:0047498	calcium-dependent phospholipase A2 activity	IEA	molecular function
GO:0046456	icosanoid biosynthetic process	IEA	biological process
GO:0043032	positive regulation of macrophage activation	IEA	biological process
GO:0034638	phosphatidylcholine catabolic process	IEA	biological process
GO:0019370	leukotriene biosynthetic process	IEA	biological process
GO:0006663	platelet activating factor biosynthetic process	IEA	biological process
GO:0004623	phospholipase A2 activity	IEA	molecular function
GO:0001516	prostaglandin biosynthetic process	IEA	biological process
GO:0000139	Golgi membrane	IEA	cellular component
GO:0005635	nuclear envelope	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005811	lipid droplet	IDA	cellular component
GO:0005829	cytosol	IDA	cellular component
GO:0001516	prostaglandin biosynthetic process	IEA	biological process
GO:0019369	arachidonic acid metabolic process	IEA	biological process
GO:0006650	glycerophospholipid metabolic process	IEA	biological process
GO:0006690	icosanoid metabolic process	NAS	biological process
GO:0006663	platelet activating factor biosynthetic process	NAS	biological process
GO:0004623	phospholipase A2 activity	NAS	molecular function
GO:0005829	cytosol	NAS	cellular component

KEGG pathways

Pathway id	Pathway name
hsa01100	Metabolic pathways
hsa04010	MAPK signaling pathway
hsa04014	Ras signaling pathway
hsa04072	Phospholipase D signaling pathway
hsa04217	Necroptosis
hsa04921	Oxytocin signaling pathway
hsa04724	Glutamatergic synapse
hsa04270	Vascular smooth muscle contraction
hsa04611	Platelet activation
hsa00564	Glycerophospholipid metabolism
hsa04726	Serotonergic synapse
hsa05231	Choline metabolism in cancer
hsa04666	Fc gamma R-mediated phagocytosis
hsa04750	Inflammatory mediator regulation of TRP channels
hsa04912	GnRH signaling pathway
hsa04664	Fc epsilon RI signaling pathway
hsa00590	Arachidonic acid metabolism
hsa04730	Long-term depression
hsa04370	VEGF signaling pathway
hsa00565	Ether lipid metabolism
hsa04913	Ovarian steroidogenesis
hsa00591	Linoleic acid metabolism
hsa00592	alpha-Linolenic acid metabolism
P06959	CCKR signaling map
P06959	CCKR signaling map
P06959	CCKR signaling map
P06959	CCKR signaling map
P06959	CCKR signaling map
P06959	CCKR signaling map

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq