• Gene id: 5320

Gene Summary

• Gene Symbol: PLA2G2A   Gene   UCSC   Ensembl
• Aliases: MOM1, PLA2, PLA2B, PLA2L, PLA2S, PLAS1, sPLA2
• Gene name: phospholipase A2 group IIA
• Alternate names: phospholipase A2, membrane associated, GIIC sPLA2, NPS-PLA2, group IIA phospholipase A2, non-pancreatic secretory phospholipase A2, phosphatidylcholine 2-acylhydrolase 2A, phospholipase A2, group IIA (platelets, synovial fluid),
• Gene location: 1p36.13 (19980438: 19975430)     Exons: 6     NC_000001.11
• Gene summary(Entrez): The protein encoded by this gene is a member of the phospholipase A2 family (PLA2). PLA2s constitute a diverse family of enzymes with respect to sequence, function, localization, and divalent cation requirements. This gene product belongs to group II, whi
• OMIM: 172411

Protein Summary

• Protein general information: P14555  
  • Name: Phospholipase A2, membrane associated (EC 3.1.1.4) (GIIC sPLA2) (Group IIA phospholipase A2) (Non pancreatic secretory phospholipase A2) (NPS PLA2) (Phosphatidylcholine 2 acylhydrolase 2A)
  • Length: 144  
  • Mass: 16,083
• Sequence:

  MKTLLLLAVIMIFGLLQAHGNLVNFHRMIKLTTGKEAALSYGFYGCHCGVGGRGSPKDATDRCCVTHDCCYKRLE
  KRGCGTKFLSYKFSNSGSRITCAKQDSCRSQLCECDKAAATCFARNKTTYNKKYQYYSNKHCRGSTPRC

• Structural information:
  • Interpro: IPR001211  IPR033112  IPR016090  IPR036444  IPR033113  
  • Prosite: PS00119 PS00118
  • CDD: cd00125
  • PDB: 1AYP 1BBC 1DB4 1DB5 1DCY 1J1A 1KQU 1KVO 1N28 1N29 1POD 1POE 2GNY 3U8B 3U8D 3U8H 3U8I 5G3N
  • PDBsum: 1AYP 1BBC 1DB4 1DB5 1DCY 1J1A 1KQU 1KVO 1N28 1N29 1POD 1POE 2GNY 3U8B 3U8D 3U8H 3U8I 5G3N
  • STRING: ENSP00000364252
• Other Databases: GeneCards:  PLA2G2A  Malacards:  PLA2G2A

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0004623	phospholipase A2 activity	IDA	molecular function
GO:0004623	phospholipase A2 activity	TAS	molecular function
GO:0004623	phospholipase A2 activity	TAS	molecular function
GO:0004623	phospholipase A2 activity	TAS	molecular function
GO:0004623	phospholipase A2 activity	TAS	molecular function
GO:0004623	phospholipase A2 activity	TAS	molecular function
GO:0004623	phospholipase A2 activity	TAS	molecular function
GO:0004623	phospholipase A2 activity	TAS	molecular function
GO:0004623	phospholipase A2 activity	TAS	molecular function
GO:0004623	phospholipase A2 activity	TAS	molecular function
GO:0004623	phospholipase A2 activity	TAS	molecular function
GO:0004623	phospholipase A2 activity	TAS	molecular function
GO:0004623	phospholipase A2 activity	TAS	molecular function
GO:0005509	calcium ion binding	IEA	molecular function
GO:0005543	phospholipid binding	IDA	molecular function
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005615	extracellular space	IDA	cellular component
GO:0005615	extracellular space	IDA	cellular component
GO:0005783	endoplasmic reticulum	IDA	cellular component
GO:0005789	endoplasmic reticulum membrane	TAS	cellular component
GO:0005789	endoplasmic reticulum membrane	TAS	cellular component
GO:0005789	endoplasmic reticulum membrane	TAS	cellular component
GO:0005789	endoplasmic reticulum membrane	TAS	cellular component
GO:0005789	endoplasmic reticulum membrane	TAS	cellular component
GO:0005789	endoplasmic reticulum membrane	TAS	cellular component
GO:0006644	phospholipid metabolic process	IDA	biological process
GO:0006654	phosphatidic acid biosynthetic process	TAS	biological process
GO:0010744	positive regulation of macrophage derived foam cell differentiation	TAS	biological process
GO:0016042	lipid catabolic process	IEA	biological process
GO:0030141	secretory granule	IEA	cellular component
GO:0034374	low-density lipoprotein particle remodeling	TAS	biological process
GO:0036148	phosphatidylglycerol acyl-chain remodeling	TAS	biological process
GO:0036149	phosphatidylinositol acyl-chain remodeling	TAS	biological process
GO:0036150	phosphatidylserine acyl-chain remodeling	TAS	biological process
GO:0036151	phosphatidylcholine acyl-chain remodeling	TAS	biological process
GO:0036152	phosphatidylethanolamine acyl-chain remodeling	TAS	biological process
GO:0046473	phosphatidic acid metabolic process	IDA	biological process
GO:0047498	calcium-dependent phospholipase A2 activity	TAS	molecular function
GO:0048471	perinuclear region of cytoplasm	IEA	cellular component
GO:0050729	positive regulation of inflammatory response	TAS	biological process
GO:0050830	defense response to Gram-positive bacterium	TAS	biological process
GO:0070062	extracellular exosome	IDA	cellular component
GO:0070374	positive regulation of ERK1 and ERK2 cascade	IDA	biological process
GO:0004623	phospholipase A2 activity	IEA	molecular function
GO:0004623	phospholipase A2 activity	IEA	molecular function
GO:0004623	phospholipase A2 activity	IDA	molecular function
GO:0004623	phospholipase A2 activity	TAS	molecular function
GO:0004623	phospholipase A2 activity	TAS	molecular function
GO:0004623	phospholipase A2 activity	TAS	molecular function
GO:0004623	phospholipase A2 activity	TAS	molecular function
GO:0004623	phospholipase A2 activity	TAS	molecular function
GO:0004623	phospholipase A2 activity	TAS	molecular function
GO:0004623	phospholipase A2 activity	TAS	molecular function
GO:0004623	phospholipase A2 activity	TAS	molecular function
GO:0004623	phospholipase A2 activity	TAS	molecular function
GO:0004623	phospholipase A2 activity	TAS	molecular function
GO:0004623	phospholipase A2 activity	TAS	molecular function
GO:0004623	phospholipase A2 activity	TAS	molecular function
GO:0005509	calcium ion binding	IEA	molecular function
GO:0005543	phospholipid binding	IDA	molecular function
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005615	extracellular space	IDA	cellular component
GO:0005615	extracellular space	IDA	cellular component
GO:0005783	endoplasmic reticulum	IDA	cellular component
GO:0005789	endoplasmic reticulum membrane	TAS	cellular component
GO:0005789	endoplasmic reticulum membrane	TAS	cellular component
GO:0005789	endoplasmic reticulum membrane	TAS	cellular component
GO:0005789	endoplasmic reticulum membrane	TAS	cellular component
GO:0005789	endoplasmic reticulum membrane	TAS	cellular component
GO:0005789	endoplasmic reticulum membrane	TAS	cellular component
GO:0006629	lipid metabolic process	IEA	biological process
GO:0006644	phospholipid metabolic process	IEA	biological process
GO:0006644	phospholipid metabolic process	IDA	biological process
GO:0006654	phosphatidic acid biosynthetic process	TAS	biological process
GO:0010744	positive regulation of macrophage derived foam cell differentiation	TAS	biological process
GO:0016020	membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0016042	lipid catabolic process	IEA	biological process
GO:0016042	lipid catabolic process	IEA	biological process
GO:0016787	hydrolase activity	IEA	molecular function
GO:0030141	secretory granule	IEA	cellular component
GO:0034374	low-density lipoprotein particle remodeling	TAS	biological process
GO:0036148	phosphatidylglycerol acyl-chain remodeling	TAS	biological process
GO:0036149	phosphatidylinositol acyl-chain remodeling	TAS	biological process
GO:0036150	phosphatidylserine acyl-chain remodeling	TAS	biological process
GO:0036151	phosphatidylcholine acyl-chain remodeling	TAS	biological process
GO:0036152	phosphatidylethanolamine acyl-chain remodeling	TAS	biological process
GO:0046473	phosphatidic acid metabolic process	IDA	biological process
GO:0046872	metal ion binding	IEA	molecular function
GO:0047498	calcium-dependent phospholipase A2 activity	IEA	molecular function
GO:0047498	calcium-dependent phospholipase A2 activity	TAS	molecular function
GO:0048471	perinuclear region of cytoplasm	IEA	cellular component
GO:0050729	positive regulation of inflammatory response	TAS	biological process
GO:0050830	defense response to Gram-positive bacterium	TAS	biological process
GO:0070062	extracellular exosome	IDA	cellular component
GO:0070374	positive regulation of ERK1 and ERK2 cascade	IDA	biological process
GO:0004623	phospholipase A2 activity	IDA	molecular function
GO:0004623	phospholipase A2 activity	TAS	molecular function
GO:0004623	phospholipase A2 activity	TAS	molecular function
GO:0004623	phospholipase A2 activity	TAS	molecular function
GO:0004623	phospholipase A2 activity	TAS	molecular function
GO:0004623	phospholipase A2 activity	TAS	molecular function
GO:0004623	phospholipase A2 activity	TAS	molecular function
GO:0004623	phospholipase A2 activity	TAS	molecular function
GO:0004623	phospholipase A2 activity	TAS	molecular function
GO:0004623	phospholipase A2 activity	TAS	molecular function
GO:0004623	phospholipase A2 activity	TAS	molecular function
GO:0004623	phospholipase A2 activity	TAS	molecular function
GO:0004623	phospholipase A2 activity	TAS	molecular function
GO:0005543	phospholipid binding	IDA	molecular function
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005615	extracellular space	IDA	cellular component
GO:0005615	extracellular space	IDA	cellular component
GO:0005783	endoplasmic reticulum	IDA	cellular component
GO:0005789	endoplasmic reticulum membrane	TAS	cellular component
GO:0005789	endoplasmic reticulum membrane	TAS	cellular component
GO:0005789	endoplasmic reticulum membrane	TAS	cellular component
GO:0005789	endoplasmic reticulum membrane	TAS	cellular component
GO:0005789	endoplasmic reticulum membrane	TAS	cellular component
GO:0005789	endoplasmic reticulum membrane	TAS	cellular component
GO:0006644	phospholipid metabolic process	IDA	biological process
GO:0006654	phosphatidic acid biosynthetic process	TAS	biological process
GO:0010744	positive regulation of macrophage derived foam cell differentiation	TAS	biological process
GO:0034374	low-density lipoprotein particle remodeling	TAS	biological process
GO:0036148	phosphatidylglycerol acyl-chain remodeling	TAS	biological process
GO:0036149	phosphatidylinositol acyl-chain remodeling	TAS	biological process
GO:0036150	phosphatidylserine acyl-chain remodeling	TAS	biological process
GO:0036151	phosphatidylcholine acyl-chain remodeling	TAS	biological process
GO:0036152	phosphatidylethanolamine acyl-chain remodeling	TAS	biological process
GO:0046473	phosphatidic acid metabolic process	IDA	biological process
GO:0047498	calcium-dependent phospholipase A2 activity	TAS	molecular function
GO:0050729	positive regulation of inflammatory response	TAS	biological process
GO:0050830	defense response to Gram-positive bacterium	TAS	biological process
GO:0070062	extracellular exosome	IDA	cellular component
GO:0070374	positive regulation of ERK1 and ERK2 cascade	IDA	biological process

KEGG pathways

Pathway id	Pathway name
hsa01100	Metabolic pathways
hsa04270	Vascular smooth muscle contraction
hsa04972	Pancreatic secretion
hsa04975	Fat digestion and absorption

Diseases

Associated diseases	References
Cancer (bladder)	GAD: 19692168
Cancer (colorectal)	GAD: 12433710
Cancer (lung)	GAD: 18676680
Colorectal cancer	OMIM: 172411
Cancer	GAD: 19692168
Cardiovascular disease	GAD: 16368710
Coronary heart disease	GAD: 19495570
Familial adenomatous polyposis	GAD: 8707313
Affective disorder	GAD: 14639048
Schizophrenia	GAD: 15318030
Recurrent empty follicle syndrome	INFBASE: 17007665
Ovarian endometriosis	INFBASE: 25366587
Male factor infertility	MIK: 26446356
Male factor infertility	MIK: 12749123
Asthenozoospermia	MIK: 26446356
Endometrial receptivity	INFBASE: 19542542
Endometriosis	INFBASE: 8150107
Chronic obstructive pulmonary disease (COPD)	GAD: 19625176
Spermatogenic defects	MIK: 20424323
Asthenozoospermia	MIK: 26446356
Male infertility	MIK: 12749123

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
12749123	Male infertility				Male infertility	PLA2
26446356	Asthenozoospermia, male factor infertility			50 (22 normozoospermic men, 28 asthenozoospermic patients)	Male infertility
20424323	Assocaited with sperm dysfunction				Male infertility
31037746	Spermatogenic defects			16 (1 control, 15 cases)	Male infertility	GSE6023 analyzed using GEO2R