• Gene id: 5319

Gene Summary

• Gene Symbol: PLA2G1B   Gene   UCSC   Ensembl
• Aliases: PLA2, PLA2A, PPLA2
• Gene name: phospholipase A2 group IB
• Alternate names: phospholipase A2, phosphatidylcholine 2-acylhydrolase 1B, phospholipase A2, group IB (pancreas),
• Gene location: 12q24.31 (120327778: 120322114)     Exons: 4     NC_000012.12
• Gene summary(Entrez): This gene encodes a secreted member of the phospholipase A2 (PLA2) class of enzymes, which is produced by the pancreatic acinar cells. The encoded calcium-dependent enzyme catalyzes the hydrolysis of the sn-2 position of membrane glycerophospholipids to r
• OMIM: 172410

Protein Summary

• Protein general information: P04054  
  • Name: Phospholipase A2 (EC 3.1.1.4) (Group IB phospholipase A2) (Phosphatidylcholine 2 acylhydrolase 1B)
  • Length: 148  
  • Mass: 16360
• Sequence:

  MKLLVLAVLLTVAAADSGISPRAVWQFRKMIKCVIPGSDPFLEYNNYGCYCGLGGSGTPVDELDKCCQTHDNCYD
  QAKKLDSCKFLLDNPYTHTYSYSCSGSAITCSSKNKECEAFICNCDRNAAICFSKAPYNKAHKNLDTKKYCQS

• Structural information:
  • Interpro: IPR001211  IPR033112  IPR016090  IPR036444  IPR033113  
  • Prosite: PS00119 PS00118
  • CDD: cd00125
  • PDB: 1YSK 3ELO
  • PDBsum: 1YSK 3ELO
  • STRING: ENSP00000312286
• Other Databases: GeneCards:  PLA2G1B  Malacards:  PLA2G1B

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0006633	fatty acid biosynthetic process	IBA	biological process
GO:0005102	signaling receptor binding	IBA	molecular function
GO:0048146	positive regulation of fibroblast proliferation	IBA	biological process
GO:0046470	phosphatidylcholine metabolic process	IDA	biological process
GO:1904635	positive regulation of glomerular visceral epithelial cell apoptotic process	IDA	biological process
GO:0046471	phosphatidylglycerol metabolic process	IDA	biological process
GO:0047498	calcium-dependent phospholipase A2 activity	IDA	molecular function
GO:0047498	calcium-dependent phospholipase A2 activity	IDA	molecular function
GO:0032052	bile acid binding	ISS	molecular function
GO:0005509	calcium ion binding	IEA	molecular function
GO:0006644	phospholipid metabolic process	IEA	biological process
GO:0004623	phospholipase A2 activity	IEA	molecular function
GO:0016042	lipid catabolic process	IEA	biological process
GO:0050482	arachidonic acid secretion	IEA	biological process
GO:0046872	metal ion binding	IEA	molecular function
GO:0005576	extracellular region	IEA	cellular component
GO:0016787	hydrolase activity	IEA	molecular function
GO:0006629	lipid metabolic process	IEA	biological process
GO:0007015	actin filament organization	TAS	biological process
GO:0007165	signal transduction	TAS	biological process
GO:0102567	phospholipase A2 activity (consuming 1,2-dipalmitoylphosphatidylcholine)	IEA	molecular function
GO:0004623	phospholipase A2 activity	IEA	molecular function
GO:0102568	phospholipase A2 activity consuming 1,2-dioleoylphosphatidylethanolamine)	IEA	molecular function
GO:0036148	phosphatidylglycerol acyl-chain remodeling	TAS	biological process
GO:0036149	phosphatidylinositol acyl-chain remodeling	TAS	biological process
GO:0036150	phosphatidylserine acyl-chain remodeling	TAS	biological process
GO:0036152	phosphatidylethanolamine acyl-chain remodeling	TAS	biological process
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0006654	phosphatidic acid biosynthetic process	TAS	biological process
GO:0036151	phosphatidylcholine acyl-chain remodeling	TAS	biological process
GO:0030141	secretory granule	IEA	cellular component
GO:0008284	positive regulation of cell population proliferation	IEA	biological process
GO:0006644	phospholipid metabolic process	IEA	biological process
GO:0006633	fatty acid biosynthetic process	IEA	biological process
GO:0005576	extracellular region	IEA	cellular component
GO:0047498	calcium-dependent phospholipase A2 activity	IEA	molecular function
GO:0009986	cell surface	IEA	cellular component
GO:0005102	signaling receptor binding	IEA	molecular function
GO:0004623	phospholipase A2 activity	IEA	molecular function
GO:0005102	signaling receptor binding	IEA	molecular function
GO:0004623	phospholipase A2 activity	IEA	molecular function
GO:0005509	calcium ion binding	IDA	molecular function
GO:0004623	phospholipase A2 activity	IDA	molecular function
GO:0005102	signaling receptor binding	IDA	molecular function
GO:0047498	calcium-dependent phospholipase A2 activity	IDA	molecular function
GO:0032052	bile acid binding	ISS	molecular function
GO:0005615	extracellular space	IDA	cellular component
GO:0006633	fatty acid biosynthetic process	IDA	biological process
GO:0008284	positive regulation of cell population proliferation	IDA	biological process
GO:0046470	phosphatidylcholine metabolic process	IDA	biological process
GO:0000187	activation of MAPK activity	ISS	biological process
GO:0000187	activation of MAPK activity	ISS	biological process
GO:0010524	positive regulation of calcium ion transport into cytosol	ISS	biological process
GO:0046324	regulation of glucose import	ISS	biological process
GO:0030593	neutrophil chemotaxis	ISS	biological process
GO:0032431	activation of phospholipase A2 activity	TAS	biological process
GO:0032869	cellular response to insulin stimulus	ISS	biological process
GO:0050778	positive regulation of immune response	ISS	biological process
GO:0051092	positive regulation of NF-kappaB transcription factor activity	ISS	biological process
GO:0009986	cell surface	IDA	cellular component
GO:0016042	lipid catabolic process	IDA	biological process
GO:0048146	positive regulation of fibroblast proliferation	IDA	biological process
GO:0002446	neutrophil mediated immunity	ISS	biological process
GO:0019370	leukotriene biosynthetic process	ISS	biological process
GO:0032637	interleukin-8 production	ISS	biological process
GO:0035556	intracellular signal transduction	ISS	biological process
GO:0045944	positive regulation of transcription by RNA polymerase II	ISS	biological process
GO:0050482	arachidonic acid secretion	TAS	biological process
GO:0050714	positive regulation of protein secretion	TAS	biological process
GO:0005576	extracellular region	IEA	cellular component
GO:0050830	defense response to Gram-positive bacterium	IDA	biological process
GO:0019731	antibacterial humoral response	IDA	biological process
GO:0005615	extracellular space	IDA	cellular component
GO:0002227	innate immune response in mucosa	IDA	biological process
GO:0061844	antimicrobial humoral immune response mediated by antimicrobial peptide	IDA	biological process
GO:0005102	signaling receptor binding	IPI	molecular function
GO:0005102	signaling receptor binding	IPI	molecular function

KEGG pathways

Pathway id	Pathway name
hsa01100	Metabolic pathways
hsa04014	Ras signaling pathway
hsa04270	Vascular smooth muscle contraction
hsa00564	Glycerophospholipid metabolism
hsa04972	Pancreatic secretion
hsa00590	Arachidonic acid metabolism
hsa00565	Ether lipid metabolism
hsa04975	Fat digestion and absorption
hsa00591	Linoleic acid metabolism
hsa00592	alpha-Linolenic acid metabolism

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)