• Gene id: 5315

Gene Summary

• Gene Symbol: PKM   Gene   UCSC   Ensembl
• Aliases: CTHBP, HEL-S-30, OIP3, PK3, PKM2, TCB, THBP1, p58
• Gene name: pyruvate kinase M1/2
• Alternate names: pyruvate kinase PKM, OPA-interacting protein 3, PK, muscle type, cytosolic thyroid hormone-binding protein, epididymis secretory protein Li 30, pyruvate kinase 2/3, pyruvate kinase isozymes M1/M2, pyruvate kinase muscle isozyme, pyruvate kinase, muscle, thyroid ho,
• Gene location: 15q23 (24094310: 24104124)     Exons: 10     NC_000014.9
• Gene summary(Entrez): This gene encodes a protein involved in glycolysis. The encoded protein is a pyruvate kinase that catalyzes the transfer of a phosphoryl group from phosphoenolpyruvate to ADP, generating ATP and pyruvate. This protein has been shown to interact with thyro
• OMIM: 179050

Protein Summary

• Protein general information: P14618  
  • Name: Pyruvate kinase PKM (EC 2.7.1.40) (Cytosolic thyroid hormone binding protein) (CTHBP) (Opa interacting protein 3) (OIP 3) (Pyruvate kinase 2/3) (Pyruvate kinase muscle isozyme) (Thyroid hormone binding protein 1) (THBP1) (Tumor M2 PK) (p58)
  • Length: 531  
  • Mass: 57937
  • Tissue specificity: Specifically expressed in proliferating cells, such as embryonic stem cells, embryonic carcinoma cells, as well as cancer cells. {ECO
• Sequence:

  MSKPHSEAGTAFIQTQQLHAAMADTFLEHMCRLDIDSPPITARNTGIICTIGPASRSVETLKEMIKSGMNVARLN
  FSHGTHEYHAETIKNVRTATESFASDPILYRPVAVALDTKGPEIRTGLIKGSGTAEVELKKGATLKITLDNAYME
  KCDENILWLDYKNICKVVEVGSKIYVDDGLISLQVKQKGADFLVTEVENGGSLGSKKGVNLPGAAVDLPAVSEKD
  IQDLKFGVEQDVDMVFASFIRKASDVHEVRKVLGEKGKNIKIISKIENHEGVRRFDEILEASDGIMVARGDLGIE
  IPAEKVFLAQKMMIGRCNRAGKPVICATQMLESMIKKPRPTRAEGSDVANAVLDGADCIMLSGETAKGDYPLEAV
  RMQHLIAREAEAAIYHLQLFEELRRLAPITSDPTEATAVGAVEASFKCCSGAIIVLTKSGRSAHQVARYRPRAPI
  IAVTRNPQTARQAHLYRGIFPVLCKDPVQEAWAEDVDLRVNFAMNVGKARGFFKKGDVVIVLTGWRPGSGFTNTM
  RVVPVP

• Structural information:
  • Interpro: IPR001697  IPR015813  IPR040442  IPR011037  IPR018209   IPR015793  IPR015795  IPR036918  IPR015806  
  • Prosite: PS00110
  • CDD: cd00288
  • PDB: 1T5A 1ZJH 3BJF 3BJT 3G2G 3GQY 3GR4 3H6O 3ME3 3SRD 3SRF 3SRH 3U2Z 4B2D 4FXF 4FXJ 4G1N 4JPG 4QG6 4QG8 4QG9 4QGC 4RPP 4WJ8 4YJ5 5X0I 5X1V 5X1W 6B6U 6GG3 6GG4 6GG5 6GG6 6NU1 6NU5 6NUB 6TTF 6TTH 6TTI 6TTQ
  • PDBsum: 1T5A 1ZJH 3BJF 3BJT 3G2G 3GQY 3GR4 3H6O 3ME3 3SRD 3SRF 3SRH 3U2Z 4B2D 4FXF 4FXJ 4G1N 4JPG 4QG6 4QG8 4QG9 4QGC 4RPP 4WJ8 4YJ5 5X0I 5X1V 5X1W 6B6U 6GG3 6GG4 6GG5 6GG6 6NU1 6NU5 6NUB 6TTF 6TTH 6TTI 6TTQ
  • DIP: 31273
  • STRING: ENSP00000320171
• Other Databases: GeneCards:  PKM  Malacards:  PKM

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0004743	pyruvate kinase activity	IDA	molecular function
GO:0032869	cellular response to insulin stimulus	IBA	biological process
GO:0004743	pyruvate kinase activity	IBA	molecular function
GO:0005737	cytoplasm	IBA	cellular component
GO:0006096	glycolytic process	IBA	biological process
GO:0012501	programmed cell death	IDA	biological process
GO:0005737	cytoplasm	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:1903672	positive regulation of sprouting angiogenesis	IMP	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0000287	magnesium ion binding	IEA	molecular function
GO:0030955	potassium ion binding	IEA	molecular function
GO:0003824	catalytic activity	IEA	molecular function
GO:0004743	pyruvate kinase activity	IEA	molecular function
GO:0006096	glycolytic process	IEA	biological process
GO:0016740	transferase activity	IEA	molecular function
GO:0008152	metabolic process	IEA	biological process
GO:0046872	metal ion binding	IEA	molecular function
GO:0016301	kinase activity	IEA	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0003824	catalytic activity	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0005524	ATP binding	IEA	molecular function
GO:0016310	phosphorylation	IEA	biological process
GO:0000166	nucleotide binding	IEA	molecular function
GO:0006096	glycolytic process	IEA	biological process
GO:0004743	pyruvate kinase activity	IEA	molecular function
GO:0043312	neutrophil degranulation	TAS	biological process
GO:0061621	canonical glycolysis	TAS	biological process
GO:1904813	ficolin-1-rich granule lumen	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0034774	secretory granule lumen	TAS	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:1902912	pyruvate kinase complex	IEA	cellular component
GO:0043403	skeletal muscle tissue regeneration	IEA	biological process
GO:0032868	response to insulin	IEA	biological process
GO:0010033	response to organic substance	IEA	biological process
GO:0007584	response to nutrient	IEA	biological process
GO:0006754	ATP biosynthetic process	IEA	biological process
GO:0006006	glucose metabolic process	IEA	biological process
GO:0001666	response to hypoxia	IEA	biological process
GO:0070324	thyroid hormone binding	IEA	molecular function
GO:0043531	ADP binding	IEA	molecular function
GO:0042866	pyruvate biosynthetic process	IEA	biological process
GO:0042802	identical protein binding	IEA	molecular function
GO:0031100	animal organ regeneration	IEA	biological process
GO:0014870	response to muscle inactivity	IEA	biological process
GO:0009629	response to gravity	IEA	biological process
GO:0006096	glycolytic process	IEA	biological process
GO:0004743	pyruvate kinase activity	IEA	molecular function
GO:0001889	liver development	IEA	biological process
GO:0006096	glycolytic process	IEA	biological process
GO:0005929	cilium	IEA	cellular component
GO:0004743	pyruvate kinase activity	IEA	molecular function
GO:0045296	cadherin binding	HDA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005829	cytosol	IDA	cellular component
GO:0006096	glycolytic process	IEA	biological process
GO:0070062	extracellular exosome	HDA	cellular component
GO:0070062	extracellular exosome	HDA	cellular component
GO:0062023	collagen-containing extracellular matrix	HDA	cellular component
GO:0070062	extracellular exosome	HDA	cellular component
GO:1903561	extracellular vesicle	HDA	cellular component
GO:0023026	MHC class II protein complex binding	HDA	molecular function
GO:0005739	mitochondrion	HDA	cellular component
GO:0070062	extracellular exosome	HDA	cellular component
GO:0070062	extracellular exosome	HDA	cellular component
GO:0005634	nucleus	HDA	cellular component
GO:0031982	vesicle	HDA	cellular component
GO:0070062	extracellular exosome	HDA	cellular component
GO:0070062	extracellular exosome	HDA	cellular component
GO:0005829	cytosol	NAS	cellular component
GO:0004743	pyruvate kinase activity	TAS	molecular function
GO:0004743	pyruvate kinase activity	TAS	molecular function
GO:0070062	extracellular exosome	HDA	cellular component
GO:0003723	RNA binding	HDA	molecular function
GO:0004743	pyruvate kinase activity	TAS	molecular function

KEGG pathways

Pathway id	Pathway name
hsa01100	Metabolic pathways
hsa05165	Human papillomavirus infection
hsa05203	Viral carcinogenesis
hsa00230	Purine metabolism
hsa01200	Carbon metabolism
hsa04922	Glucagon signaling pathway
hsa01230	Biosynthesis of amino acids
hsa00010	Glycolysis / Gluconeogenesis
hsa04930	Type II diabetes mellitus
hsa05230	Central carbon metabolism in cancer
hsa00620	Pyruvate metabolism

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)