• Gene id: 5304

Gene Summary

• Gene Symbol: PIP   Gene   UCSC   Ensembl
• Aliases: GCDFP-15, GCDFP15, GPIP4
• Gene name: prolactin induced protein
• Alternate names: prolactin-inducible protein, SABP, gross cystic disease fluid protein 15, secretory actin-binding protein,
• Gene location: 7q34 (143132080: 143139740)     Exons: 4     NC_000007.14
• OMIM: 176720

Protein Summary

• Protein general information: P12273  
  • Name: Prolactin inducible protein (Gross cystic disease fluid protein 15) (GCDFP 15) (Prolactin induced protein) (Secretory actin binding protein) (SABP) (gp17)
  • Length: 146  
  • Mass: 16,572
• Sequence:

  MRLLQLLFRASPATLLLVLCLQLGANKAQDNTRKIIIKNFDIPKSVRPNDEVTAVLAVQTELKECMVVKTYLISS
  IPLQGAFNYKYTACLCDDNPKTFYWDFYTNRTVQIAAVVDVIRELGICPDDAAVIPIKNNRFYTIEILKVE

• Structural information:
  • Interpro: IPR013783  IPR014756  IPR007990  
  • PDB: 3ES6
  • PDBsum: 3ES6
  • STRING: ENSP00000291009
• Other Databases: GeneCards:  PIP  Malacards:  PIP

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0001580	detection of chemical stimulus involved in sensory perception of bitter taste	IDA	biological process
GO:0001895	retina homeostasis	IEP	biological process
GO:0001948	glycoprotein binding	IPI	molecular function
GO:0002682	regulation of immune system process	IEA	biological process
GO:0003779	actin binding	NAS	molecular function
GO:0004190	aspartic-type endopeptidase activity	IMP	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005576	extracellular region	TAS	cellular component
GO:0005615	extracellular space	IDA	cellular component
GO:0005615	extracellular space	IDA	cellular component
GO:0005615	extracellular space	IDA	cellular component
GO:0005615	extracellular space	IDA	cellular component
GO:0005615	extracellular space	IDA	cellular component
GO:0005615	extracellular space	IDA	cellular component
GO:0005615	extracellular space	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0006508	proteolysis	IMP	biological process
GO:0010628	positive regulation of gene expression	IDA	biological process
GO:0016324	apical plasma membrane	IEA	cellular component
GO:0019864	IgG binding	IDA	molecular function
GO:0046983	protein dimerization activity	IDA	molecular function
GO:0055085	transmembrane transport	TAS	biological process
GO:0070062	extracellular exosome	IDA	cellular component
GO:0070062	extracellular exosome	IDA	cellular component
GO:0070062	extracellular exosome	IDA	cellular component
GO:0070062	extracellular exosome	IDA	cellular component
GO:0070233	negative regulation of T cell apoptotic process	IMP	biological process
GO:0001580	detection of chemical stimulus involved in sensory perception of bitter taste	IDA	biological process
GO:0001895	retina homeostasis	IEP	biological process
GO:0001948	glycoprotein binding	IPI	molecular function
GO:0002682	regulation of immune system process	IEA	biological process
GO:0003779	actin binding	IEA	molecular function
GO:0003779	actin binding	NAS	molecular function
GO:0004190	aspartic-type endopeptidase activity	IMP	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005576	extracellular region	IEA	cellular component
GO:0005576	extracellular region	IEA	cellular component
GO:0005576	extracellular region	IEA	cellular component
GO:0005576	extracellular region	IEA	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005615	extracellular space	IDA	cellular component
GO:0005615	extracellular space	IDA	cellular component
GO:0005615	extracellular space	IDA	cellular component
GO:0005615	extracellular space	IDA	cellular component
GO:0005615	extracellular space	IDA	cellular component
GO:0005615	extracellular space	IDA	cellular component
GO:0005615	extracellular space	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0006508	proteolysis	IMP	biological process
GO:0010628	positive regulation of gene expression	IDA	biological process
GO:0016324	apical plasma membrane	IEA	cellular component
GO:0019864	IgG binding	IDA	molecular function
GO:0046983	protein dimerization activity	IDA	molecular function
GO:0055085	transmembrane transport	TAS	biological process
GO:0070062	extracellular exosome	IDA	cellular component
GO:0070062	extracellular exosome	IDA	cellular component
GO:0070062	extracellular exosome	IDA	cellular component
GO:0070062	extracellular exosome	IDA	cellular component
GO:0070233	negative regulation of T cell apoptotic process	IMP	biological process
GO:0001580	detection of chemical stimulus involved in sensory perception of bitter taste	IDA	biological process
GO:0001895	retina homeostasis	IEP	biological process
GO:0001948	glycoprotein binding	IPI	molecular function
GO:0003779	actin binding	NAS	molecular function
GO:0004190	aspartic-type endopeptidase activity	IMP	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005576	extracellular region	TAS	cellular component
GO:0005615	extracellular space	IDA	cellular component
GO:0005615	extracellular space	IDA	cellular component
GO:0005615	extracellular space	IDA	cellular component
GO:0005615	extracellular space	IDA	cellular component
GO:0005615	extracellular space	IDA	cellular component
GO:0005615	extracellular space	IDA	cellular component
GO:0005615	extracellular space	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0006508	proteolysis	IMP	biological process
GO:0010628	positive regulation of gene expression	IDA	biological process
GO:0019864	IgG binding	IDA	molecular function
GO:0046983	protein dimerization activity	IDA	molecular function
GO:0055085	transmembrane transport	TAS	biological process
GO:0070062	extracellular exosome	IDA	cellular component
GO:0070062	extracellular exosome	IDA	cellular component
GO:0070062	extracellular exosome	IDA	cellular component
GO:0070062	extracellular exosome	IDA	cellular component
GO:0070233	negative regulation of T cell apoptotic process	IMP	biological process

Diseases

Associated diseases	References
Cancer	GAD: 10390157
Cancer (prostate)	GAD: 10390157
Allergic rhinitis	GAD: 19650845
Allergy	GAD: 19650845
Azoospermia	MIK: 22182811
Oligoasthenozoospermia	MIK: 25779018
Male factor infertility	MIK: 25355644
Oligozoospermia	MIK: 22724438
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Azoospermia	MIK: 22182811
Oligozoospermia	MIK: 22724438
Oligoasthenozoospermia	MIK: 25729253
Male infertility	MIK: 25355644
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
25355644	Male infertility				Male infertility	SEMG1 PIP GAPDHS PGK2
25779018	Oligoasthenozoospermia			20 (10 men with normozoospermia, 10 men with idiopathic oligoasthenozoospermia)	Male infertility
25729253	idiopathic oligoasthenozoospermia			20 (10 men with normozoospermia, 10 men with idiopathic oligoasthenozoospermia)	Male infertility
22182811	Azoospermia, Oligospermia				Male infertility	Lactoferrin Prostatic acid phosphatase Human Zinc-Alpha-2-Glycoprotein Prostate specific antigen Progestagen-associated endometrial protein Kinesin light chain 4 Kinesin light chain 4 Prolactin inducible protein Izumo sperm-egg fusion protein 1
22724438	Azoospermia, Oligozoospermia				Male infertility	PIP
22209935	Male infertility, Male fertility				Male infertility
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881