• Gene id: 5296

Gene Summary

• Gene Symbol: PIK3R2   Gene   UCSC   Ensembl
• Aliases: MPPH, MPPH1, P85B, p85, p85-BETA
• Gene name: phosphoinositide-3-kinase regulatory subunit 2
• Alternate names: phosphatidylinositol 3-kinase regulatory subunit beta, PI3-kinase subunit p85-beta, PI3K regulatory subunit beta, phosphatidylinositol 3-kinase 85 kDa regulatory subunit beta, phosphatidylinositol 3-kinase, regulatory subunit, polypeptide 2 (p85 beta), phospho,
• Gene location: 19p13.11 (18153162: 18170531)     Exons: 16     NC_000019.10
• Gene summary(Entrez): Phosphatidylinositol 3-kinase (PI3K) is a lipid kinase that phosphorylates phosphatidylinositol and similar compounds, creating second messengers important in growth signaling pathways. PI3K functions as a heterodimer of a regulatory and a catalytic subun
• OMIM: 105850

Protein Summary

• Protein general information: O00459  
  • Name: Phosphatidylinositol 3 kinase regulatory subunit beta (PI3 kinase regulatory subunit beta) (PI3K regulatory subunit beta) (PtdIns 3 kinase regulatory subunit beta) (Phosphatidylinositol 3 kinase 85 kDa regulatory subunit beta) (PI3 kinase subunit p85 beta
  • Length: 728  
  • Mass: 81545
• Sequence:

  MAGPEGFQYRALYPFRRERPEDLELLPGDVLVVSRAALQALGVAEGGERCPQSVGWMPGLNERTRQRGDFPGTYV
  EFLGPVALARPGPRPRGPRPLPARPRDGAPEPGLTLPDLPEQFSPPDVAPPLLVKLVEAIERTGLDSESHYRPEL
  PAPRTDWSLSDVDQWDTAALADGIKSFLLALPAPLVTPEASAEARRALREAAGPVGPALEPPTLPLHRALTLRFL
  LQHLGRVASRAPALGPAVRALGATFGPLLLRAPPPPSSPPPGGAPDGSEPSPDFPALLVEKLLQEHLEEQEVAPP
  ALPPKPPKAKPASTVLANGGSPPSLQDAEWYWGDISREEVNEKLRDTPDGTFLVRDASSKIQGEYTLTLRKGGNN
  KLIKVFHRDGHYGFSEPLTFCSVVDLINHYRHESLAQYNAKLDTRLLYPVSKYQQDQIVKEDSVEAVGAQLKVYH
  QQYQDKSREYDQLYEEYTRTSQELQMKRTAIEAFNETIKIFEEQGQTQEKCSKEYLERFRREGNEKEMQRILLNS
  ERLKSRIAEIHESRTKLEQQLRAQASDNREIDKRMNSLKPDLMQLRKIRDQYLVWLTQKGARQKKINEWLGIKNE
  TEDQYALMEDEDDLPHHEERTWYVGKINRTQAEEMLSGKRDGTFLIRESSQRGCYACSVVVDGDTKHCVIYRTAT
  GFGFAEPYNLYGSLKELVLHYQHASLVQHNDALTVTLAHPVRAPGPGPPPAAR

• Structural information:
  • Protein Domains: (4..8-)
    (/note="SH3-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00192-)
    (109..29-)
    (/note="Rho-GAP-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00172-)
    (330..42-)
    (/note="SH2-1)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00191-)
    (-)
  • Interpro: IPR032498  IPR035586  IPR035020  IPR035022  IPR008936   IPR000198  IPR000980  IPR036860  IPR036028  IPR001452  
  • Prosite: PS50238 PS50001 PS50002
  • CDD: cd09930 cd09942 cd11909
  • PDB: 2KT1 2XS6 3MTT 3O5Z
  • PDBsum: 2KT1 2XS6 3MTT 3O5Z
  • DIP: 31811
  • STRING: ENSP00000222254
• Other Databases: GeneCards:  PIK3R2  Malacards:  PIK3R2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0046982	protein heterodimerization activity	ISS	molecular function
GO:0046935	1-phosphatidylinositol-3-kinase regulator activity	IBA	molecular function
GO:0043551	regulation of phosphatidylinositol 3-kinase activity	IBA	biological process
GO:0008286	insulin receptor signaling pathway	IBA	biological process
GO:0005942	phosphatidylinositol 3-kinase complex	IBA	cellular component
GO:0046854	phosphatidylinositol phosphorylation	IBA	biological process
GO:0014065	phosphatidylinositol 3-kinase signaling	IDA	biological process
GO:0042307	positive regulation of protein import into nucleus	ISS	biological process
GO:0032869	cellular response to insulin stimulus	ISS	biological process
GO:0010506	regulation of autophagy	IMP	biological process
GO:0005634	nucleus	ISS	cellular component
GO:0045944	positive regulation of transcription by RNA polymerase II	ISS	biological process
GO:0034976	response to endoplasmic reticulum stress	ISS	biological process
GO:0001678	cellular glucose homeostasis	ISS	biological process
GO:0019903	protein phosphatase binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0007165	signal transduction	IEA	biological process
GO:0015031	protein transport	IEA	biological process
GO:0006661	phosphatidylinositol biosynthetic process	TAS	biological process
GO:0048015	phosphatidylinositol-mediated signaling	TAS	biological process
GO:0050852	T cell receptor signaling pathway	TAS	biological process
GO:0051897	positive regulation of protein kinase B signaling	TAS	biological process
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0038095	Fc-epsilon receptor signaling pathway	TAS	biological process
GO:0038096	Fc-gamma receptor signaling pathway involved in phagocytosis	TAS	biological process
GO:0048010	vascular endothelial growth factor receptor signaling pathway	TAS	biological process
GO:0050900	leukocyte migration	TAS	biological process
GO:0051056	regulation of small GTPase mediated signal transduction	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0043409	negative regulation of MAPK cascade	IMP	biological process
GO:0001784	phosphotyrosine residue binding	IPI	molecular function
GO:0030971	receptor tyrosine kinase binding	IPI	molecular function

KEGG pathways

Pathway id	Pathway name
hsa05200	Pathways in cancer
hsa05168	Herpes simplex virus 1 infection
hsa05010	Alzheimer disease
hsa04151	PI3K-Akt signaling pathway
hsa05165	Human papillomavirus infection
hsa05206	MicroRNAs in cancer
hsa05131	Shigellosis
hsa04014	Ras signaling pathway
hsa04810	Regulation of actin cytoskeleton
hsa04015	Rap1 signaling pathway
hsa04024	cAMP signaling pathway
hsa05166	Human T-cell leukemia virus 1 infection
hsa05163	Human cytomegalovirus infection
hsa04062	Chemokine signaling pathway
hsa04510	Focal adhesion
hsa04360	Axon guidance
hsa05170	Human immunodeficiency virus 1 infection
hsa05203	Viral carcinogenesis
hsa05205	Proteoglycans in cancer
hsa05169	Epstein-Barr virus infection
hsa05167	Kaposi sarcoma-associated herpesvirus infection
hsa04150	mTOR signaling pathway
hsa05225	Hepatocellular carcinoma
hsa05017	Spinocerebellar ataxia
hsa04072	Phospholipase D signaling pathway
hsa04140	Autophagy - animal
hsa04932	Non-alcoholic fatty liver disease
hsa04630	JAK-STAT signaling pathway
hsa05164	Influenza A
hsa04910	Insulin signaling pathway
hsa05226	Gastric cancer
hsa04218	Cellular senescence
hsa05161	Hepatitis B
hsa04550	Signaling pathways regulating pluripotency of stem cells
hsa05224	Breast cancer
hsa04380	Osteoclast differentiation
hsa05160	Hepatitis C
hsa05418	Fluid shear stress and atherosclerosis
hsa05135	Yersinia infection
hsa04611	Platelet activation
hsa04210	Apoptosis
hsa04926	Relaxin signaling pathway
hsa04722	Neurotrophin signaling pathway
hsa04071	Sphingolipid signaling pathway
hsa04725	Cholinergic synapse
hsa04152	AMPK signaling pathway
hsa04068	FoxO signaling pathway
hsa04670	Leukocyte transendothelial migration
hsa04070	Phosphatidylinositol signaling system
hsa04935	Growth hormone synthesis, secretion and action
hsa05162	Measles
hsa04919	Thyroid hormone signaling pathway
hsa04915	Estrogen signaling pathway
hsa04650	Natural killer cell mediated cytotoxicity
hsa05231	Choline metabolism in cancer
hsa04668	TNF signaling pathway
hsa04625	C-type lectin receptor signaling pathway
hsa04660	T cell receptor signaling pathway
hsa04931	Insulin resistance
hsa04666	Fc gamma R-mediated phagocytosis
hsa04750	Inflammatory mediator regulation of TRP channels
hsa04620	Toll-like receptor signaling pathway
hsa04066	HIF-1 signaling pathway
hsa04662	B cell receptor signaling pathway
hsa04914	Progesterone-mediated oocyte maturation
hsa05235	PD-L1 expression and PD-1 checkpoint pathway in cancer
hsa05142	Chagas disease
hsa05222	Small cell lung cancer
hsa04012	ErbB signaling pathway
hsa04211	Longevity regulating pathway
hsa04933	AGE-RAGE signaling pathway in diabetic complications
hsa01522	Endocrine resistance
hsa05146	Amoebiasis
hsa05100	Bacterial invasion of epithelial cells
hsa05210	Colorectal cancer
hsa05220	Chronic myeloid leukemia
hsa05215	Prostate cancer
hsa05214	Glioma
hsa04664	Fc epsilon RI signaling pathway
hsa05212	Pancreatic cancer
hsa01521	EGFR tyrosine kinase inhibitor resistance
hsa04917	Prolactin signaling pathway
hsa05221	Acute myeloid leukemia
hsa05211	Renal cell carcinoma
hsa05218	Melanoma
hsa05223	Non-small cell lung cancer
hsa04929	GnRH secretion
hsa04213	Longevity regulating pathway - multiple species
hsa04930	Type II diabetes mellitus
hsa04370	VEGF signaling pathway
hsa05213	Endometrial cancer
hsa04923	Regulation of lipolysis in adipocytes
hsa05230	Central carbon metabolism in cancer
hsa01524	Platinum drug resistance
hsa04973	Carbohydrate digestion and absorption
hsa04960	Aldosterone-regulated sodium reabsorption

Diseases

Associated diseases	References
Megalencephaly-polymicrogyria-polydactyly-hydrocephalus syndrome	KEGG:H01885
Megalencephaly-polymicrogyria-polydactyly-hydrocephalus syndrome	KEGG:H01885
Prostate cancer	PMID:26677064
colon cancer	PMID:18663744
pancreatic ductal adenocarcinoma	PMID:15591514
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq