• Gene id: 5294

Gene Summary

• Gene Symbol: PIK3CG   Gene   UCSC   Ensembl
• Aliases: PI3CG, PI3K, PI3Kgamma, PIK3, p110gamma, p120-PI3K
• Gene name: phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit gamma
• Alternate names: phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit gamma isoform, 1-phosphatidylinositol 3-kinase, PI3-kinase subunit gamma, phosphatidylinositol 3 kinase gamma, p110 gamma, phosphatidylinositol 3-kinase catalytic 110-kD gamma, phosphatidylinosit,
• Gene location: 7q22.3 (106865281: 106908979)     Exons: 15     NC_000007.14
• Gene summary(Entrez): Phosphoinositide 3-kinases (PI3Ks) phosphorylate inositol lipids and are involved in the immune response. The protein encoded by this gene is a class I catalytic subunit of PI3K. Like other class I catalytic subunits (p110-alpha p110-beta, and p110-delta)
• OMIM: 606211

Protein Summary

• Protein general information: P48736  
  • Name: Phosphatidylinositol 4,5 bisphosphate 3 kinase catalytic subunit gamma isoform (PI3 kinase subunit gamma) (PI3K gamma) (PI3Kgamma) (PtdIns 3 kinase subunit gamma) (EC 2.7.1.153) (Phosphatidylinositol 4,5 bisphosphate 3 kinase 110 kDa catalytic subunit gam
  • Length: 1102  
  • Mass: 126454
  • Tissue specificity: Pancreas, skeletal muscle, liver and heart. {ECO
• Sequence:

  MELENYKQPVVLREDNCRRRRRMKPRSAAASLSSMELIPIEFVLPTSQRKCKSPETALLHVAGHGNVEQMKAQVW
  LRALETSVAADFYHRLGPHHFLLLYQKKGQWYEIYDKYQVVQTLDCLRYWKATHRSPGQIHLVQRHPPSEESQAF
  QRQLTALIGYDVTDVSNVHDDELEFTRRGLVTPRMAEVASRDPKLYAMHPWVTSKPLPEYLWKKIANNCIFIVIH
  RSTTSQTIKVSPDDTPGAILQSFFTKMAKKKSLMDIPESQSEQDFVLRVCGRDEYLVGETPIKNFQWVRHCLKNG
  EEIHVVLDTPPDPALDEVRKEEWPLVDDCTGVTGYHEQLTIHGKDHESVFTVSLWDCDRKFRVKIRGIDIPVLPR
  NTDLTVFVEANIQHGQQVLCQRRTSPKPFTEEVLWNVWLEFSIKIKDLPKGALLNLQIYCGKAPALSSKASAESP
  SSESKGKVQLLYYVNLLLIDHRFLLRRGEYVLHMWQISGKGEDQGSFNADKLTSATNPDKENSMSISILLDNYCH
  PIALPKHQPTPDPEGDRVRAEMPNQLRKQLEAIIATDPLNPLTAEDKELLWHFRYESLKHPKAYPKLFSSVKWGQ
  QEIVAKTYQLLARREVWDQSALDVGLTMQLLDCNFSDENVRAIAVQKLESLEDDDVLHYLLQLVQAVKFEPYHDS
  ALARFLLKRGLRNKRIGHFLFWFLRSEIAQSRHYQQRFAVILEAYLRGCGTAMLHDFTQQVQVIEMLQKVTLDIK
  SLSAEKYDVSSQVISQLKQKLENLQNSQLPESFRVPYDPGLKAGALAIEKCKVMASKKKPLWLEFKCADPTALSN
  ETIGIIFKHGDDLRQDMLILQILRIMESIWETESLDLCLLPYGCISTGDKIGMIEIVKDATTIAKIQQSTVGNTG
  AFKDEVLNHWLKEKSPTEEKFQAAVERFVYSCAGYCVATFVLGIGDRHNDNIMITETGNLFHIDFGHILGNYKSF
  LGINKERVPFVLTPDFLFVMGTSGKKTSPHFQKFQDICVKAYLALRHHTNLLIILFSMMLMTGMPQLTSKEDIEY
  IRDALTVGKNEEDAKKYFLDQIEVCRDKGWTVQFNWFLHLVLGIKQGEKHSA

• Structural information:
  • Protein Domains: (34..14-)
    (/note="PI3K-ABD-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00877-)
    (217..30-)
    (/note="PI3K-RBD-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00879-)
    (357..52-)
    (/note="C2-PI3K-type)
    (/evidence="ECO:0000255|PROSITE-ProRule:PR-)
  • Interpro: IPR016024  IPR035892  IPR011009  IPR000403  IPR036940   IPR018936  IPR001263  IPR042236  IPR003113  IPR002420  IPR000341  IPR008290  IPR015433  IPR029071  
  • Prosite: PS51547 PS00915 PS00916 PS50290 PS51544 PS51546 PS51545
  • PDB: 1E8Y 1E8Z 1HE8 2A4Z 2A5U 2CHW 2CHX 2CHZ 2V4L 3APC 3APD 3APF 3CSF 3CST 3DBS 3DPD 3ENE 3IBE 3L08 3L13 3L16 3L17 3L54 3LJ3 3MJW 3ML8 3ML9 3NZS 3NZU 3OAW 3P2B 3PRE 3PRZ 3PS6 3QAQ 3QAR 3QJZ 3QK0 3R7Q 3R7R 3S2A 3SD5 3T8M 3TJP 3TL5 3ZVV 3ZW3 4ANU 4ANV 4ANW 4ANX 4AOF 4DK5 4EZJ 4EZK 4EZL 4F1S 4FA6 4FAD 4FHJ 4FHK 4FJY 4FJZ 4FL
  • PDBsum: 1E8Y 1E8Z 1HE8 2A4Z 2A5U 2CHW 2CHX 2CHZ 2V4L 3APC 3APD 3APF 3CSF 3CST 3DBS 3DPD 3ENE 3IBE 3L08 3L13 3L16 3L17 3L54 3LJ3 3MJW 3ML8 3ML9 3NZS 3NZU 3OAW 3P2B 3PRE 3PRZ 3PS6 3QAQ 3QAR 3QJZ 3QK0 3R7Q 3R7R 3S2A 3SD5 3T8M 3TJP 3TL5 3ZVV 3ZW3 4ANU 4ANV 4ANW 4ANX 4AOF 4DK5 4EZJ 4EZK 4EZL 4F1S 4FA6 4FAD 4FHJ 4FHK 4FJY 4FJZ 4FL
  • DIP: 37781
  • STRING: ENSP00000352121
• Other Databases: GeneCards:  PIK3CG  Malacards:  PIK3CG

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005737	cytoplasm	IBA	cellular component
GO:0005886	plasma membrane	IBA	cellular component
GO:0005944	phosphatidylinositol 3-kinase complex, class IB	IBA	cellular component
GO:0016020	membrane	IBA	cellular component
GO:0016303	1-phosphatidylinositol-3-kinase activity	IBA	molecular function
GO:0035005	1-phosphatidylinositol-4-phosphate 3-kinase activity	IBA	molecular function
GO:0036092	phosphatidylinositol-3-phosphate biosynthetic process	IBA	biological process
GO:0046854	phosphatidylinositol phosphorylation	IBA	biological process
GO:0048015	phosphatidylinositol-mediated signaling	IBA	biological process
GO:0005942	phosphatidylinositol 3-kinase complex	IBA	cellular component
GO:0014065	phosphatidylinositol 3-kinase signaling	IBA	biological process
GO:0016477	cell migration	IBA	biological process
GO:0052742	phosphatidylinositol kinase activity	IBA	molecular function
GO:0043406	positive regulation of MAP kinase activity	IDA	biological process
GO:0014065	phosphatidylinositol 3-kinase signaling	IDA	biological process
GO:0051897	positive regulation of protein kinase B signaling	IDA	biological process
GO:0016020	membrane	IDA	cellular component
GO:0007186	G protein-coupled receptor signaling pathway	IDA	biological process
GO:0005944	phosphatidylinositol 3-kinase complex, class IB	IDA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0046875	ephrin receptor binding	IPI	molecular function
GO:0016301	kinase activity	IEA	molecular function
GO:0046854	phosphatidylinositol phosphorylation	IEA	biological process
GO:0048015	phosphatidylinositol-mediated signaling	IEA	biological process
GO:0016740	transferase activity	IEA	molecular function
GO:0016301	kinase activity	IEA	molecular function
GO:0002376	immune system process	IEA	biological process
GO:0001525	angiogenesis	IEA	biological process
GO:0006954	inflammatory response	IEA	biological process
GO:0005524	ATP binding	IEA	molecular function
GO:0005886	plasma membrane	IEA	cellular component
GO:0000166	nucleotide binding	IEA	molecular function
GO:0016020	membrane	IEA	cellular component
GO:0006935	chemotaxis	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0006897	endocytosis	IEA	biological process
GO:0016310	phosphorylation	IEA	biological process
GO:0004674	protein serine/threonine kinase activity	IEA	molecular function
GO:0016303	1-phosphatidylinositol-3-kinase activity	TAS	molecular function
GO:0007186	G protein-coupled receptor signaling pathway	TAS	biological process
GO:0052812	phosphatidylinositol-3,4-bisphosphate 5-kinase activity	IEA	molecular function
GO:0046934	phosphatidylinositol-4,5-bisphosphate 3-kinase activity	IEA	molecular function
GO:0016301	kinase activity	IDA	molecular function
GO:0016310	phosphorylation	IDA	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0006661	phosphatidylinositol biosynthetic process	TAS	biological process
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0014068	positive regulation of phosphatidylinositol 3-kinase signaling	TAS	biological process
GO:0030168	platelet activation	TAS	biological process
GO:0042802	identical protein binding	IPI	molecular function
GO:0042802	identical protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0046854	phosphatidylinositol phosphorylation	IEA	biological process
GO:0032252	secretory granule localization	IEA	biological process
GO:0016303	1-phosphatidylinositol-3-kinase activity	IEA	molecular function
GO:0007204	positive regulation of cytosolic calcium ion concentration	IEA	biological process
GO:0043085	positive regulation of catalytic activity	IEA	biological process
GO:0006468	protein phosphorylation	IEA	biological process
GO:0001932	regulation of protein phosphorylation	IEA	biological process
GO:0097284	hepatocyte apoptotic process	IEA	biological process
GO:0010897	negative regulation of triglyceride catabolic process	IEA	biological process
GO:0005942	phosphatidylinositol 3-kinase complex	IEA	cellular component
GO:0002675	positive regulation of acute inflammatory response	IEA	biological process
GO:2000270	negative regulation of fibroblast apoptotic process	IEA	biological process
GO:1903169	regulation of calcium ion transmembrane transport	IEA	biological process
GO:0071320	cellular response to cAMP	IEA	biological process
GO:0005886	plasma membrane	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005886	plasma membrane	IDA	cellular component
GO:0005829	cytosol	IDA	cellular component
GO:0042629	mast cell granule	IEA	cellular component
GO:0016020	membrane	HDA	cellular component
GO:0055118	negative regulation of cardiac muscle contraction	TAS	biological process
GO:0045087	innate immune response	TAS	biological process
GO:0042098	T cell proliferation	TAS	biological process
GO:0072672	neutrophil extravasation	TAS	biological process
GO:0070527	platelet aggregation	TAS	biological process
GO:0006954	inflammatory response	TAS	biological process
GO:0004672	protein kinase activity	TAS	molecular function
GO:0002679	respiratory burst involved in defense response	TAS	biological process
GO:0043303	mast cell degranulation	TAS	biological process
GO:0042110	T cell activation	TAS	biological process
GO:0030593	neutrophil chemotaxis	TAS	biological process
GO:0014065	phosphatidylinositol 3-kinase signaling	TAS	biological process
GO:0035747	natural killer cell chemotaxis	TAS	biological process
GO:0035004	phosphatidylinositol 3-kinase activity	TAS	molecular function
GO:0033628	regulation of cell adhesion mediated by integrin	TAS	biological process
GO:0010818	T cell chemotaxis	TAS	biological process
GO:0002407	dendritic cell chemotaxis	TAS	biological process
GO:0002250	adaptive immune response	TAS	biological process
GO:0001816	cytokine production	TAS	biological process
GO:0005737	cytoplasm	IBA	cellular component
GO:0005886	plasma membrane	IBA	cellular component
GO:0005944	phosphatidylinositol 3-kinase complex, class IB	IBA	cellular component
GO:0016020	membrane	IBA	cellular component
GO:0016303	1-phosphatidylinositol-3-kinase activity	IBA	molecular function
GO:0035005	1-phosphatidylinositol-4-phosphate 3-kinase activity	IBA	molecular function
GO:0036092	phosphatidylinositol-3-phosphate biosynthetic process	IBA	biological process
GO:0046854	phosphatidylinositol phosphorylation	IBA	biological process
GO:0048015	phosphatidylinositol-mediated signaling	IBA	biological process
GO:0005942	phosphatidylinositol 3-kinase complex	IBA	cellular component
GO:0014065	phosphatidylinositol 3-kinase signaling	IBA	biological process
GO:0016477	cell migration	IBA	biological process
GO:0052742	phosphatidylinositol kinase activity	IBA	molecular function
GO:0043406	positive regulation of MAP kinase activity	IDA	biological process
GO:0014065	phosphatidylinositol 3-kinase signaling	IDA	biological process
GO:0051897	positive regulation of protein kinase B signaling	IDA	biological process
GO:0016020	membrane	IDA	cellular component
GO:0007186	G protein-coupled receptor signaling pathway	IDA	biological process
GO:0005944	phosphatidylinositol 3-kinase complex, class IB	IDA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0046875	ephrin receptor binding	IPI	molecular function
GO:0016301	kinase activity	IEA	molecular function
GO:0046854	phosphatidylinositol phosphorylation	IEA	biological process
GO:0048015	phosphatidylinositol-mediated signaling	IEA	biological process
GO:0016740	transferase activity	IEA	molecular function
GO:0016301	kinase activity	IEA	molecular function
GO:0002376	immune system process	IEA	biological process
GO:0001525	angiogenesis	IEA	biological process
GO:0006954	inflammatory response	IEA	biological process
GO:0005524	ATP binding	IEA	molecular function
GO:0005886	plasma membrane	IEA	cellular component
GO:0000166	nucleotide binding	IEA	molecular function
GO:0016020	membrane	IEA	cellular component
GO:0006935	chemotaxis	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0006897	endocytosis	IEA	biological process
GO:0016310	phosphorylation	IEA	biological process
GO:0004674	protein serine/threonine kinase activity	IEA	molecular function
GO:0016303	1-phosphatidylinositol-3-kinase activity	TAS	molecular function
GO:0007186	G protein-coupled receptor signaling pathway	TAS	biological process
GO:0052812	phosphatidylinositol-3,4-bisphosphate 5-kinase activity	IEA	molecular function
GO:0046934	phosphatidylinositol-4,5-bisphosphate 3-kinase activity	IEA	molecular function
GO:0016301	kinase activity	IDA	molecular function
GO:0016310	phosphorylation	IDA	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0006661	phosphatidylinositol biosynthetic process	TAS	biological process
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0014068	positive regulation of phosphatidylinositol 3-kinase signaling	TAS	biological process
GO:0030168	platelet activation	TAS	biological process
GO:0042802	identical protein binding	IPI	molecular function
GO:0042802	identical protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0046854	phosphatidylinositol phosphorylation	IEA	biological process
GO:0032252	secretory granule localization	IEA	biological process
GO:0016303	1-phosphatidylinositol-3-kinase activity	IEA	molecular function
GO:0007204	positive regulation of cytosolic calcium ion concentration	IEA	biological process
GO:0043085	positive regulation of catalytic activity	IEA	biological process
GO:0006468	protein phosphorylation	IEA	biological process
GO:0001932	regulation of protein phosphorylation	IEA	biological process
GO:0097284	hepatocyte apoptotic process	IEA	biological process
GO:0010897	negative regulation of triglyceride catabolic process	IEA	biological process
GO:0005942	phosphatidylinositol 3-kinase complex	IEA	cellular component
GO:0002675	positive regulation of acute inflammatory response	IEA	biological process
GO:2000270	negative regulation of fibroblast apoptotic process	IEA	biological process
GO:1903169	regulation of calcium ion transmembrane transport	IEA	biological process
GO:0071320	cellular response to cAMP	IEA	biological process
GO:0005886	plasma membrane	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005886	plasma membrane	IDA	cellular component
GO:0005829	cytosol	IDA	cellular component
GO:0042629	mast cell granule	IEA	cellular component
GO:0016020	membrane	HDA	cellular component
GO:0055118	negative regulation of cardiac muscle contraction	TAS	biological process
GO:0045087	innate immune response	TAS	biological process
GO:0042098	T cell proliferation	TAS	biological process
GO:0072672	neutrophil extravasation	TAS	biological process
GO:0070527	platelet aggregation	TAS	biological process
GO:0006954	inflammatory response	TAS	biological process
GO:0004672	protein kinase activity	TAS	molecular function
GO:0002679	respiratory burst involved in defense response	TAS	biological process
GO:0043303	mast cell degranulation	TAS	biological process
GO:0042110	T cell activation	TAS	biological process
GO:0030593	neutrophil chemotaxis	TAS	biological process
GO:0014065	phosphatidylinositol 3-kinase signaling	TAS	biological process
GO:0035747	natural killer cell chemotaxis	TAS	biological process
GO:0035004	phosphatidylinositol 3-kinase activity	TAS	molecular function
GO:0033628	regulation of cell adhesion mediated by integrin	TAS	biological process
GO:0010818	T cell chemotaxis	TAS	biological process
GO:0002407	dendritic cell chemotaxis	TAS	biological process
GO:0002250	adaptive immune response	TAS	biological process
GO:0001816	cytokine production	TAS	biological process

KEGG pathways

Pathway id	Pathway name
hsa01100	Metabolic pathways
hsa04151	PI3K-Akt signaling pathway
hsa04062	Chemokine signaling pathway
hsa04022	cGMP-PKG signaling pathway
hsa05167	Kaposi sarcoma-associated herpesvirus infection
hsa04261	Adrenergic signaling in cardiomyocytes
hsa04072	Phospholipase D signaling pathway
hsa04921	Oxytocin signaling pathway
hsa04371	Apelin signaling pathway
hsa04611	Platelet activation
hsa04725	Cholinergic synapse
hsa05145	Toxoplasmosis
hsa00562	Inositol phosphate metabolism

Diseases

Associated diseases	References
autistic disorder	PMID:14627686
pancreatic ductal adenocarcinoma	PMID:20876794
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Associated with spermatogenesis and epigenetic regulation	MIK: 21674046

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Associated with spermatogenesis and epigenetic regulation			18	Male infertility	GSE26881
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881