• Gene id: 5289

Gene Summary

• Gene Symbol: PIK3C3   Gene   UCSC   Ensembl
• Aliases: VPS34, Vps34, hVps34
• Gene name: phosphatidylinositol 3-kinase catalytic subunit type 3
• Alternate names: phosphatidylinositol 3-kinase catalytic subunit type 3, PI3-kinase type 3, PI3K type 3, PtdIns-3-kinase type 3, phosphatidylinositol 3-kinase p100 subunit, phosphoinositide-3-kinase, class 3,
• Gene location: 18q12.3 (133661967: 133600237)     Exons: 28     NC_000003.12
• OMIM: 602609

Protein Summary

• Protein general information: Q8NEB9  
  • Name: Phosphatidylinositol 3 kinase catalytic subunit type 3 (PI3 kinase type 3) (PI3K type 3) (PtdIns 3 kinase type 3) (EC 2.7.1.137) (Phosphatidylinositol 3 kinase p100 subunit) (Phosphoinositide 3 kinase class 3) (hVps34)
  • Length: 887  
  • Mass: 101549
  • Tissue specificity: Ubiquitously expressed, with a highest expression in skeletal muscle. {ECO
• Sequence:

  MGEAEKFHYIYSCDLDINVQLKIGSLEGKREQKSYKAVLEDPMLKFSGLYQETCSDLYVTCQVFAEGKPLALPVR
  TSYKAFSTRWNWNEWLKLPVKYPDLPRNAQVALTIWDVYGPGKAVPVGGTTVSLFGKYGMFRQGMHDLKVWPNVE
  ADGSEPTKTPGRTSSTLSEDQMSRLAKLTKAHRQGHMVKVDWLDRLTFREIEMINESEKRSSNFMYLMVEFRCVK
  CDDKEYGIVYYEKDGDESSPILTSFELVKVPDPQMSMENLVESKHHKLARSLRSGPSDHDLKPNAATRDQLNIIV
  SYPPTKQLTYEEQDLVWKFRYYLTNQEKALTKFLKCVNWDLPQEAKQALELLGKWKPMDVEDSLELLSSHYTNPT
  VRRYAVARLRQADDEDLLMYLLQLVQALKYENFDDIKNGLEPTKKDSQSSVSENVSNSGINSAEIDSSQIITSPL
  PSVSSPPPASKTKEVPDGENLEQDLCTFLISRACKNSTLANYLYWYVIVECEDQDTQQRDPKTHEMYLNVMRRFS
  QALLKGDKSVRVMRSLLAAQQTFVDRLVHLMKAVQRESGNRKKKNERLQALLGDNEKMNLSDVELIPLPLEPQVK
  IRGIIPETATLFKSALMPAQLFFKTEDGGKYPVIFKHGDDLRQDQLILQIISLMDKLLRKENLDLKLTPYKVLAT
  STKHGFMQFIQSVPVAEVLDTEGSIQNFFRKYAPSENGPNGISAEVMDTYVKSCAGYCVITYILGVGDRHLDNLL
  LTKTGKLFHIDFGYILGRDPKPLPPPMKLNKEMVEGMGGTQSEQYQEFRKQCYTAFLHLRRYSNLILNLFSLMVD
  ANIPDIALEPDKTVKKVQDKFRLDLSDEEAVHYMQSLIDESVHALFAAVVEQIHKFAQYWRK

• Structural information:
  • Protein Domains: (35..18-)
    (/note="C2-PI3K-type)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00880-)
    (283..52-)
    (/note="PIK-helical)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00878-)
    (631..88-)
    (/note="PI3K/PI4K-)
    (/evidence="ECO:0000255|PROSITE-ProRul-)
  • Interpro: IPR016024  IPR035892  IPR011009  IPR000403  IPR036940   IPR018936  IPR001263  IPR042236  IPR002420  IPR008290  IPR015433  
  • Prosite: PS51547 PS00915 PS00916 PS50290 PS51545
  • PDB: 3IHY 3LS8 4OYS 4PH4 4UWF 4UWG 4UWH 4UWK 4UWL 5ANL 5ENN 6I3U
  • PDBsum: 3IHY 3LS8 4OYS 4PH4 4UWF 4UWG 4UWH 4UWK 4UWL 5ANL 5ENN 6I3U
  • DIP: 42272
  • STRING: ENSP00000262039
• Other Databases: GeneCards:  PIK3C3  Malacards:  PIK3C3

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0000407	phagophore assembly site	IBA	cellular component
GO:0005768	endosome	IBA	cellular component
GO:0034272	phosphatidylinositol 3-kinase complex, class III, type II	IBA	cellular component
GO:0052742	phosphatidylinositol kinase activity	IBA	molecular function
GO:0000045	autophagosome assembly	IBA	biological process
GO:0005737	cytoplasm	IBA	cellular component
GO:0005777	peroxisome	IBA	cellular component
GO:0006897	endocytosis	IBA	biological process
GO:0016020	membrane	IBA	cellular component
GO:0016303	1-phosphatidylinositol-3-kinase activity	IBA	molecular function
GO:0030242	autophagy of peroxisome	IBA	biological process
GO:0034271	phosphatidylinositol 3-kinase complex, class III, type I	IBA	cellular component
GO:0036092	phosphatidylinositol-3-phosphate biosynthetic process	IBA	biological process
GO:0046854	phosphatidylinositol phosphorylation	IBA	biological process
GO:0048015	phosphatidylinositol-mediated signaling	IBA	biological process
GO:0030496	midbody	IDA	cellular component
GO:0005770	late endosome	IDA	cellular component
GO:0005930	axoneme	ISS	cellular component
GO:0042149	cellular response to glucose starvation	ISS	biological process
GO:0045022	early endosome to late endosome transport	IMP	biological process
GO:0016303	1-phosphatidylinositol-3-kinase activity	IMP	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0032465	regulation of cytokinesis	IMP	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0035032	phosphatidylinositol 3-kinase complex, class III	ISS	cellular component
GO:0016236	macroautophagy	ISS	biological process
GO:0032465	regulation of cytokinesis	IMP	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0016301	kinase activity	IEA	molecular function
GO:0016303	1-phosphatidylinositol-3-kinase activity	IEA	molecular function
GO:0046854	phosphatidylinositol phosphorylation	IEA	biological process
GO:0048015	phosphatidylinositol-mediated signaling	IEA	biological process
GO:0031410	cytoplasmic vesicle	IEA	cellular component
GO:0016740	transferase activity	IEA	molecular function
GO:0016301	kinase activity	IEA	molecular function
GO:0005768	endosome	IEA	cellular component
GO:0051301	cell division	IEA	biological process
GO:0006914	autophagy	IEA	biological process
GO:0000166	nucleotide binding	IEA	molecular function
GO:0005524	ATP binding	IEA	molecular function
GO:0007049	cell cycle	IEA	biological process
GO:0016310	phosphorylation	IEA	biological process
GO:0016303	1-phosphatidylinositol-3-kinase activity	TAS	molecular function
GO:0016303	1-phosphatidylinositol-3-kinase activity	IEA	molecular function
GO:0044754	autolysosome	IDA	cellular component
GO:0016301	kinase activity	IDA	molecular function
GO:0006914	autophagy	IMP	biological process
GO:0006497	protein lipidation	IMP	biological process
GO:0006661	phosphatidylinositol biosynthetic process	TAS	biological process
GO:0006661	phosphatidylinositol biosynthetic process	TAS	biological process
GO:0006661	phosphatidylinositol biosynthetic process	TAS	biological process
GO:0016236	macroautophagy	TAS	biological process
GO:0016303	1-phosphatidylinositol-3-kinase activity	TAS	molecular function
GO:0016303	1-phosphatidylinositol-3-kinase activity	TAS	molecular function
GO:0030670	phagocytic vesicle membrane	TAS	cellular component
GO:0034162	toll-like receptor 9 signaling pathway	TAS	biological process
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0042149	cellular response to glucose starvation	IEA	biological process
GO:0034497	protein localization to phagophore assembly site	IEA	biological process
GO:0016485	protein processing	IEA	biological process
GO:0007032	endosome organization	IEA	biological process
GO:0045335	phagocytic vesicle	IEA	cellular component
GO:0036092	phosphatidylinositol-3-phosphate biosynthetic process	IEA	biological process
GO:0035032	phosphatidylinositol 3-kinase complex, class III	IEA	cellular component
GO:0016236	macroautophagy	IEA	biological process
GO:0009267	cellular response to starvation	IEA	biological process
GO:0006468	protein phosphorylation	IEA	biological process
GO:0004672	protein kinase activity	IEA	molecular function
GO:0000045	autophagosome assembly	IEA	biological process
GO:0050708	regulation of protein secretion	IEA	biological process
GO:0048015	phosphatidylinositol-mediated signaling	IEA	biological process
GO:0043201	response to leucine	IEA	biological process
GO:0035004	phosphatidylinositol 3-kinase activity	IEA	molecular function
GO:0016303	1-phosphatidylinositol-3-kinase activity	IEA	molecular function
GO:0000045	autophagosome assembly	IEA	biological process
GO:0005776	autophagosome	IEA	cellular component
GO:0005770	late endosome	IEA	cellular component
GO:0030496	midbody	IEA	cellular component
GO:0016020	membrane	HDA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function

KEGG pathways

Pathway id	Pathway name
hsa01100	Metabolic pathways
hsa05010	Alzheimer disease
hsa05016	Huntington disease
hsa05131	Shigellosis
hsa05132	Salmonella infection
hsa05167	Kaposi sarcoma-associated herpesvirus infection
hsa05017	Spinocerebellar ataxia
hsa04140	Autophagy - animal
hsa05152	Tuberculosis
hsa04145	Phagosome
hsa04371	Apelin signaling pathway
hsa04070	Phosphatidylinositol signaling system
hsa00562	Inositol phosphate metabolism
hsa04136	Autophagy - other

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881