• Gene id: 5284

Gene Summary

• Gene Symbol: PIGR   Gene   UCSC   Ensembl
• Gene name: polymeric immunoglobulin receptor
• Alternate names: polymeric immunoglobulin receptor, hepatocellular carcinoma associated protein TB6, poly-Ig receptor,
• Gene location: 1q32.1 (206946465: 206928521)     Exons: 4     NC_000001.11
• Gene summary(Entrez): This gene is a member of the immunoglobulin superfamily. The encoded poly-Ig receptor binds polymeric immunoglobulin molecules at the basolateral surface of epithelial cells; the complex is then transported across the cell to be secreted at the apical sur
• OMIM: 173880

Protein Summary

• Protein general information: P01833  
  • Name: Polymeric immunoglobulin receptor (PIgR) (Poly Ig receptor) (Hepatocellular carcinoma associated protein TB6) [Cleaved into: Secretory component]
  • Length: 764  
  • Mass: 83284
• Sequence:

  MLLFVLTCLLAVFPAISTKSPIFGPEEVNSVEGNSVSITCYYPPTSVNRHTRKYWCRQGARGGCITLISSEGYVS
  SKYAGRANLTNFPENGTFVVNIAQLSQDDSGRYKCGLGINSRGLSFDVSLEVSQGPGLLNDTKVYTVDLGRTVTI
  NCPFKTENAQKRKSLYKQIGLYPVLVIDSSGYVNPNYTGRIRLDIQGTGQLLFSVVINQLRLSDAGQYLCQAGDD
  SNSNKKNADLQVLKPEPELVYEDLRGSVTFHCALGPEVANVAKFLCRQSSGENCDVVVNTLGKRAPAFEGRILLN
  PQDKDGSFSVVITGLRKEDAGRYLCGAHSDGQLQEGSPIQAWQLFVNEESTIPRSPTVVKGVAGGSVAVLCPYNR
  KESKSIKYWCLWEGAQNGRCPLLVDSEGWVKAQYEGRLSLLEEPGNGTFTVILNQLTSRDAGFYWCLTNGDTLWR
  TTVEIKIIEGEPNLKVPGNVTAVLGETLKVPCHFPCKFSSYEKYWCKWNNTGCQALPSQDEGPSKAFVNCDENSR
  LVSLTLNLVTRADEGWYWCGVKQGHFYGETAAVYVAVEERKAAGSRDVSLAKADAAPDEKVLDSGFREIENKAIQ
  DPRLFAEEKAVADTRDQADGSRASVDSGSSEEQGGSSRALVSTLVPLGLVLAVGAVAVGVARARHRKNVDRVSIR
  SYRTDISMSDFENSREFGANDNMGASSITQETSLGGKEEFVATTESTTETKEPKKAKRSSKEEAEMAYKDFLLQS
  STVAAEAQDGPQEA

• Structural information:
  • Protein Domains: (19..12-)
    1 (/note="Ig-like-V-type)
    (145..23-)
    2 (/note="Ig-like-V-type)
    (250..35-)
    3 (/note="Ig-like-V-type)
    (364..45-)
    4 (/note="Ig-like-V-type)
    (462..56-)
    5" (/note="Ig-like-V-type)
  • Interpro: IPR007110  IPR036179  IPR013783  IPR003599  IPR013106  
  • Prosite: PS50835
  • PDB: 1XED 2OCW 3CHN 3CM9 5D4K
  • PDBsum: 1XED 2OCW 3CHN 3CM9 5D4K
  • STRING: ENSP00000348888
• Other Databases: GeneCards:  PIGR  Malacards:  PIGR

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005576	extracellular region	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0005887	integral component of plasma membrane	TAS	cellular component
GO:0043235	receptor complex	IDA	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0035577	azurophil granule membrane	TAS	cellular component
GO:0043312	neutrophil degranulation	TAS	biological process
GO:0005576	extracellular region	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0005615	extracellular space	IDA	cellular component
GO:0007173	epidermal growth factor receptor signaling pathway	IDA	biological process
GO:0038093	Fc receptor signaling pathway	IDA	biological process
GO:0001895	retina homeostasis	HEP	biological process
GO:0043113	receptor clustering	IDA	biological process
GO:0005886	plasma membrane	IDA	cellular component
GO:0002415	immunoglobulin transcytosis in epithelial cells mediated by polymeric immunoglobulin receptor	IDA	biological process
GO:0001792	polymeric immunoglobulin receptor activity	IDA	molecular function
GO:0001580	detection of chemical stimulus involved in sensory perception of bitter taste	IDA	biological process
GO:0005615	extracellular space	HDA	cellular component
GO:0005615	extracellular space	HDA	cellular component
GO:0070062	extracellular exosome	HDA	cellular component
GO:0070062	extracellular exosome	HDA	cellular component
GO:0070062	extracellular exosome	HDA	cellular component
GO:0005615	extracellular space	HDA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa04672	Intestinal immune network for IgA production

Diseases

Associated diseases	References
Spermatogenic defects	MIK: 31037746
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
31037746	Spermatogenic defects			16 (1 control, 15 cases)	Male infertility	GSE6023 analyzed using GEO2R