• Gene id: 5274

Gene Summary

• Gene Symbol: SERPINI1   Gene   UCSC   Ensembl
• Aliases: PI12, neuroserpin
• Gene name: serpin family I member 1
• Alternate names: neuroserpin, PI-12, peptidase inhibitor 12, serine (or cysteine) proteinase inhibitor, clade I (neuroserpin), member 1, serpin I1, serpin peptidase inhibitor clade I member 1, serpin peptidase inhibitor, clade I (neuroserpin), member 1,
• Gene location: 3q26.1 (167735720: 167825568)     Exons: 9     NC_000003.12
• Gene summary(Entrez): This gene encodes a member of the serpin superfamily of serine proteinase inhibitors. The protein is primarily secreted by axons in the brain, and preferentially reacts with and inhibits tissue-type plasminogen activator. It is thought to play a role in t
• OMIM: 300189

Protein Summary

• Protein general information: Q99574  
  • Name: Neuroserpin (Peptidase inhibitor 12) (PI 12) (Serpin I1)
  • Length: 410  
  • Mass: 46427
  • Tissue specificity: Detected in brain cortex and hippocampus pyramidal neurons (at protein level) (PubMed
• Sequence:

  MAFLGLFSLLVLQSMATGATFPEEAIADLSVNMYNRLRATGEDENILFSPLSIALAMGMMELGAQGSTQKEIRHS
  MGYDSLKNGEEFSFLKEFSNMVTAKESQYVMKIANSLFVQNGFHVNEEFLQMMKKYFNAAVNHVDFSQNVAVANY
  INKWVENNTNNLVKDLVSPRDFDAATYLALINAVYFKGNWKSQFRPENTRTFSFTKDDESEVQIPMMYQQGEFYY
  GEFSDGSNEAGGIYQVLEIPYEGDEISMMLVLSRQEVPLATLEPLVKAQLVEEWANSVKKQKVEVYLPRFTVEQE
  IDLKDVLKALGITEIFIKDANLTGLSDNKEIFLSKAIHKSFLEVNEEGSEAAAVSGMIAISRMAVLYPQVIVDHP
  FFFLIRNRRTGTILFMGRVMHPETMNTSGHDFEEL

• Structural information:
  • Interpro: IPR023795  IPR023796  IPR000215  IPR036186  IPR042178   IPR042185  
  • Prosite: PS00284
  • PDB: 3F02 3F5N 3FGQ
  • PDBsum: 3F02 3F5N 3FGQ
  • STRING: ENSP00000295777
• Other Databases: GeneCards:  SERPINI1  Malacards:  SERPINI1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0010976	positive regulation of neuron projection development	ISS	biological process
GO:0004867	serine-type endopeptidase inhibitor activity	IBA	molecular function
GO:0010951	negative regulation of endopeptidase activity	IBA	biological process
GO:0005615	extracellular space	IBA	cellular component
GO:0005615	extracellular space	IDA	cellular component
GO:0060205	cytoplasmic vesicle lumen	IDA	cellular component
GO:0043025	neuronal cell body	IDA	cellular component
GO:0004867	serine-type endopeptidase inhibitor activity	IDA	molecular function
GO:0004867	serine-type endopeptidase inhibitor activity	IDA	molecular function
GO:0005615	extracellular space	IEA	cellular component
GO:0005576	extracellular region	IEA	cellular component
GO:0031410	cytoplasmic vesicle	IEA	cellular component
GO:0010466	negative regulation of peptidase activity	IEA	biological process
GO:0030414	peptidase inhibitor activity	IEA	molecular function
GO:0004867	serine-type endopeptidase inhibitor activity	IEA	molecular function
GO:0007422	peripheral nervous system development	TAS	biological process
GO:0007417	central nervous system development	TAS	biological process
GO:0030155	regulation of cell adhesion	IEA	biological process
GO:0034774	secretory granule lumen	IEA	cellular component
GO:0010976	positive regulation of neuron projection development	IEA	biological process
GO:0004867	serine-type endopeptidase inhibitor activity	IEA	molecular function
GO:0043025	neuronal cell body	IEA	cellular component
GO:0005576	extracellular region	IEA	cellular component
GO:0043204	perikaryon	IEA	cellular component
GO:0070062	extracellular exosome	HDA	cellular component

Diseases

Associated diseases	References
Familial encephalopathy with neuroserpin inclusion bodies	KEGG:H01212
Familial encephalopathy with neuroserpin inclusion bodies	KEGG:H01212
Aberrant CpGs in Low Motility Sperm	MIK: 21674046

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881