• Gene id: 5272

Gene Summary

• Gene Symbol: SERPINB9   Gene   UCSC   Ensembl
• Aliases: CAP-3, CAP3, PI-9, PI9
• Gene name: serpin family B member 9
• Alternate names: serpin B9, cytoplasmic antiproteinase 3, peptidase inhibitor 9, protease inhibitor 9 (ovalbumin type), serine (or cysteine) proteinase inhibitor, clade B (ovalbumin), member 9, serpin peptidase inhibitor, clade B (ovalbumin), member 9, serpin peptidase inhibito,
• Gene location: 6p25.2 (65860243: 65867652)     Exons: 18     NC_000011.10
• Gene summary(Entrez): This gene encodes a member of the serine protease inhibitor family which are also known as serpins. The encoded protein belongs to a subfamily of intracellular serpins. This protein inhibits the activity of the effector molecule granzyme B. Overexpression
• OMIM: 601799

Protein Summary

• Protein general information: P50453  
  • Name: Serpin B9 (Cytoplasmic antiproteinase 3) (CAP 3) (CAP3) (Peptidase inhibitor 9) (PI 9)
  • Length: 376  
  • Mass: 42404
• Sequence:

  METLSNASGTFAIRLLKILCQDNPSHNVFCSPVSISSALAMVLLGAKGNTATQMAQALSLNTEEDIHRAFQSLLT
  EVNKAGTQYLLRTANRLFGEKTCQFLSTFKESCLQFYHAELKELSFIRAAEESRKHINTWVSKKTEGKIEELLPG
  SSIDAETRLVLVNAIYFKGKWNEPFDETYTREMPFKINQEEQRPVQMMYQEATFKLAHVGEVRAQLLELPYARKE
  LSLLVLLPDDGVELSTVEKSLTFEKLTAWTKPDCMKSTEVEVLLPKFKLQEDYDMESVLRHLGIVDAFQQGKADL
  SAMSAERDLCLSKFVHKSFVEVNEEGTEAAAASSCFVVAECCMESGPRFCADHPFLFFIRHNRANSILFCGRFSS
  P

• Structural information:
  • Interpro: IPR000240  IPR023795  IPR023796  IPR000215  IPR036186   IPR042178  IPR042185  
  • Prosite: PS00284
  • STRING: ENSP00000370074
• Other Databases: GeneCards:  SERPINB9  Malacards:  SERPINB9

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0010951	negative regulation of endopeptidase activity	IBA	biological process
GO:0005737	cytoplasm	IBA	cellular component
GO:0004867	serine-type endopeptidase inhibitor activity	IBA	molecular function
GO:0005615	extracellular space	IBA	cellular component
GO:0005615	extracellular space	IEA	cellular component
GO:0004867	serine-type endopeptidase inhibitor activity	IEA	molecular function
GO:0030414	peptidase inhibitor activity	IEA	molecular function
GO:0010466	negative regulation of peptidase activity	IEA	biological process
GO:0004867	serine-type endopeptidase inhibitor activity	IEA	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0062023	collagen-containing extracellular matrix	HDA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0005794	Golgi apparatus	IDA	cellular component
GO:0005829	cytosol	IDA	cellular component
GO:0043154	negative regulation of cysteine-type endopeptidase activity involved in apoptotic process	IEA	biological process
GO:0043154	negative regulation of cysteine-type endopeptidase activity involved in apoptotic process	IEA	biological process
GO:0006915	apoptotic process	IEA	biological process
GO:0006915	apoptotic process	IEA	biological process
GO:0006955	immune response	IDA	biological process
GO:0005737	cytoplasm	IDA	cellular component
GO:0009617	response to bacterium	IDA	biological process
GO:0005829	cytosol	IDA	cellular component
GO:0005615	extracellular space	IDA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0043027	cysteine-type endopeptidase inhibitor activity involved in apoptotic process	IDA	molecular function
GO:0005634	nucleus	IDA	cellular component
GO:0004867	serine-type endopeptidase inhibitor activity	IDA	molecular function
GO:0004867	serine-type endopeptidase inhibitor activity	IDA	molecular function
GO:0070062	extracellular exosome	HDA	cellular component
GO:0016020	membrane	HDA	cellular component
GO:0070062	extracellular exosome	HDA	cellular component
GO:0033668	negative regulation by symbiont of host apoptotic process	IMP	biological process
GO:0042270	protection from natural killer cell mediated cytotoxicity	IMP	biological process
GO:0043066	negative regulation of apoptotic process	IMP	biological process
GO:0010951	negative regulation of endopeptidase activity	IMP	biological process
GO:0043027	cysteine-type endopeptidase inhibitor activity involved in apoptotic process	IMP	molecular function
GO:0002020	protease binding	IPI	molecular function
GO:0010628	positive regulation of gene expression	IMP	biological process
GO:0043066	negative regulation of apoptotic process	IMP	biological process
GO:0071391	cellular response to estrogen stimulus	IEP	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0002448	mast cell mediated immunity	IEP	biological process

KEGG pathways

Pathway id	Pathway name
hsa05146	Amoebiasis

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200
Hypospermatogenesis	MIK: 28361989
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
28361989	Hypospermatogenesis			6 (3 controls, 3 Klienfelter syndrome	Male infertility	Microarray