• Gene id: 5271

Gene Summary

• Gene Symbol: SERPINB8   Gene   UCSC   Ensembl
• Aliases: C18orf53, CAP2, PI-8, PI8, PSS5
• Gene name: serpin family B member 8
• Alternate names: serpin B8, cytoplasmic antiproteinase 2, peptidase inhibitor 8, protease inhibitor 8 (ovalbumin type), serine (or cysteine) proteinase inhibitor, clade B (ovalbumin), member 8, serpin peptidase inhibitor, clade B (ovalbumin), member 8,
• Gene location: 18q22.1 (63970028: 64019778)     Exons: 10     NC_000018.10
• Gene summary(Entrez): The protein encoded by this gene is a member of the ov-serpin family of serine protease inhibitors. The encoded protein is produced by platelets and can bind to and inhibit the function of furin, a serine protease involved in platelet functions. In additi
• OMIM: 182453

Protein Summary

• Protein general information: P50452  
  • Name: Serpin B8 (Cytoplasmic antiproteinase 2) (CAP 2) (CAP2) (Peptidase inhibitor 8) (PI 8)
  • Length: 374  
  • Mass: 42767
• Sequence:

  MDDLCEANGTFAISLFKILGEEDNSRNVFFSPMSISSALAMVFMGAKGSTAAQMSQALCLYKDGDIHRGFQSLLS
  EVNRTGTQYLLRTANRLFGEKTCDFLPDFKEYCQKFYQAELEELSFAEDTEECRKHINDWVAEKTEGKISEVLDA
  GTVDPLTKLVLVNAIYFKGKWNEQFDRKYTRGMLFKTNEEKKTVQMMFKEAKFKMGYADEVHTQVLELPYVEEEL
  SMVILLPDDNTDLAVVEKALTYEKFKAWTNSEKLTKSKVQVFLPRLKLEESYDLEPFLRRLGMIDAFDEAKADFS
  GMSTEKNVPLSKVAHKCFVEVNEEGTEAAAATAVVRNSRCSRMEPRFCADHPFLFFIRHHKTNCILFCGRFSSP

• Structural information:
  • Interpro: IPR023795  IPR023796  IPR000215  IPR036186  IPR042178   IPR042185  
  • Prosite: PS00284
  • STRING: ENSP00000381072
• Other Databases: GeneCards:  SERPINB8  Malacards:  SERPINB8

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005615	extracellular space	IBA	cellular component
GO:0004867	serine-type endopeptidase inhibitor activity	IBA	molecular function
GO:0005737	cytoplasm	IBA	cellular component
GO:0010951	negative regulation of endopeptidase activity	IBA	biological process
GO:0090136	epithelial cell-cell adhesion	IMP	biological process
GO:0005615	extracellular space	IEA	cellular component
GO:0010466	negative regulation of peptidase activity	IEA	biological process
GO:0030414	peptidase inhibitor activity	IEA	molecular function
GO:0004867	serine-type endopeptidase inhibitor activity	IEA	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0062023	collagen-containing extracellular matrix	HDA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0010951	negative regulation of endopeptidase activity	IDA	biological process
GO:0004867	serine-type endopeptidase inhibitor activity	IDA	molecular function
GO:0005829	cytosol	IDA	cellular component
GO:0070062	extracellular exosome	HDA	cellular component
GO:0005515	protein binding	IPI	molecular function

Diseases

Associated diseases	References
Peeling skin syndrome	KEGG:H00737
Peeling skin syndrome	KEGG:H00737
Aberrant CpGs in Low Motility Sperm	MIK: 21674046

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881