• Gene id: 5268

Gene Summary

• Gene Symbol: SERPINB5   Gene   UCSC   Ensembl
• Aliases: PI5, maspin
• Gene name: serpin family B member 5
• Alternate names: serpin B5, PI-5, peptidase inhibitor 5, protease inhibitor 5 (maspin), serine (or cysteine) proteinase inhibitor, clade B (ovalbumin), member 5, serpin peptidase inhibitor, clade B (ovalbumin), member 5,
• Gene location: 18q21.33 (63476957: 63505084)     Exons: 8     NC_000018.10
• OMIM: 154790

Protein Summary

• Protein general information: P36952  
  • Name: Serpin B5 (Maspin) (Peptidase inhibitor 5) (PI 5)
  • Length: 375  
  • Mass: 42100
  • Tissue specificity: Normal mammary epithelial cells.
• Sequence:

  MDALQLANSAFAVDLFKQLCEKEPLGNVLFSPICLSTSLSLAQVGAKGDTANEIGQVLHFENVKDVPFGFQTVTS
  DVNKLSSFYSLKLIKRLYVDKSLNLSTEFISSTKRPYAKELETVDFKDKLEETKGQINNSIKDLTDGHFENILAD
  NSVNDQTKILVVNAAYFVGKWMKKFSESETKECPFRVNKTDTKPVQMMNMEATFCMGNIDSINCKIIELPFQNKH
  LSMFILLPKDVEDESTGLEKIEKQLNSESLSQWTNPSTMANAKVKLSIPKFKVEKMIDPKACLENLGLKHIFSED
  TSDFSGMSETKGVALSNVIHKVCLEITEDGGDSIEVPGARILQHKDELNADHPFIYIIRHNKTRNIIFFGKFCSP

• Structural information:
  • Interpro: IPR000240  IPR023795  IPR023796  IPR000215  IPR036186   IPR042178  IPR042185  IPR033836  
  • Prosite: PS00284
  • CDD: cd02057
  • PDB: 1WZ9 1XQG 1XQJ 1XU8
  • PDBsum: 1WZ9 1XQG 1XQJ 1XU8
  • STRING: ENSP00000372221
• Other Databases: GeneCards:  SERPINB5  Malacards:  SERPINB5

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005615	extracellular space	IBA	cellular component
GO:0010951	negative regulation of endopeptidase activity	IBA	biological process
GO:0004867	serine-type endopeptidase inhibitor activity	IBA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005615	extracellular space	IEA	cellular component
GO:0004867	serine-type endopeptidase inhibitor activity	IEA	molecular function
GO:0005576	extracellular region	IEA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0050678	regulation of epithelial cell proliferation	IEA	biological process
GO:0002009	morphogenesis of an epithelium	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0030198	extracellular matrix organization	IEA	biological process
GO:0060512	prostate gland morphogenesis	IEA	biological process
GO:0005615	extracellular space	IEA	cellular component
GO:0005737	cytoplasm	IDA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa05206	MicroRNAs in cancer
hsa04115	p53 signaling pathway

Diseases

Associated diseases	References
hepatocellular carcinoma	PMID:26296971
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269
Unexplained infertility	MIK: 25753583

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
25753583	Unexplained infertility			46 (17 fertile men, 29 male patients)	Male infertility	Microarray