• Gene id: 5250

Gene Summary

• Gene Symbol: SLC25A3   Gene   UCSC   Ensembl
• Aliases: OK/SW-cl.48, PHC, PTP
• Gene name: solute carrier family 25 member 3
• Alternate names: phosphate carrier protein, mitochondrial, phosphate transport protein, solute carrier family 25 (mitochondrial carrier; phosphate carrier), member 3,
• Gene location: 12q23.1 (98593624: 98606366)     Exons: 9     NC_000012.12
• Gene summary(Entrez): The protein encoded by this gene catalyzes the transport of phosphate into the mitochondrial matrix, either by proton cotransport or in exchange for hydroxyl ions. The protein contains three related segments arranged in tandem which are related to those f
• OMIM: 600370

Protein Summary

• Protein general information: Q00325  
  • Name: Phosphate carrier protein, mitochondrial (Phosphate transport protein) (PTP) (Solute carrier family 25 member 3)
  • Length: 362  
  • Mass: 40095
• Sequence:

  MFSSVAHLARANPFNTPHLQLVHDGLGDLRSSSPGPTGQPRRPRNLAAAAVEEQYSCDYGSGRFFILCGLGGIIS
  CGTTHTALVPLDLVKCRMQVDPQKYKGIFNGFSVTLKEDGVRGLAKGWAPTFLGYSMQGLCKFGFYEVFKVLYSN
  MLGEENTYLWRTSLYLAASASAEFFADIALAPMEAAKVRIQTQPGYANTLRDAAPKMYKEEGLKAFYKGVAPLWM
  RQIPYTMMKFACFERTVEALYKFVVPKPRSECSKPEQLVVTFVAGYIAGVFCAIVSHPADSVVSVLNKEKGSSAS
  LVLKRLGFKGVWKGLFARIIMIGTLTALQWFIYDSVKVYFRLPRPPPPEMPESLKKKLGLTQ

• Structural information:
  • Interpro: IPR018108  IPR023395  
  • Prosite: PS50920
  • STRING: ENSP00000228318
• Other Databases: GeneCards:  SLC25A3  Malacards:  SLC25A3

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0035435	phosphate ion transmembrane transport	IBA	biological process
GO:0031305	integral component of mitochondrial inner membrane	IBA	cellular component
GO:0005315	inorganic phosphate transmembrane transporter activity	IBA	molecular function
GO:0005743	mitochondrial inner membrane	IEA	cellular component
GO:0005739	mitochondrion	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0015293	symporter activity	IEA	molecular function
GO:0015317	phosphate:proton symporter activity	TAS	molecular function
GO:0005887	integral component of plasma membrane	TAS	cellular component
GO:0005739	mitochondrion	TAS	cellular component
GO:0005743	mitochondrial inner membrane	TAS	cellular component
GO:0044877	protein-containing complex binding	IDA	molecular function
GO:0005743	mitochondrial inner membrane	IEA	cellular component
GO:0005739	mitochondrion	IDA	cellular component
GO:1902600	proton transmembrane transport	IEA	biological process
GO:0070062	extracellular exosome	HDA	cellular component
GO:0016020	membrane	HDA	cellular component

Diseases

Associated diseases	References
Mitochondrial phosphate carrier deficiency	KEGG:H01348
Mitochondrial phosphate carrier deficiency	KEGG:H01348
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881