About Us

Search Result


Gene id 5238
Gene Summary    Protein Summary    Gene ontology    KEGG pathways    Diseases    PubMed    

Gene Summary

Gene Symbol PGM3   Gene   UCSC   Ensembl
Aliases AGM1, IMD23, PAGM, PGM 3
Gene name phosphoglucomutase 3
Alternate names phosphoacetylglucosamine mutase, N-acetylglucosamine-phosphate mutase 1, acetylglucosamine phosphomutase,
Gene location 6q14.1 (83193899: 83150727)     Exons: 19     NC_000006.12
Gene summary(Entrez) This gene encodes a member of the phosphohexose mutase family. The encoded protein mediates both glycogen formation and utilization by catalyzing the interconversion of glucose-1-phosphate and glucose-6-phosphate. A non-synonymous single nucleotide polymo
OMIM 172100

Protein Summary

Protein general information O95394  

Name: Phosphoacetylglucosamine mutase (PAGM) (EC 5.4.2.3) (Acetylglucosamine phosphomutase) (N acetylglucosamine phosphate mutase) (Phosphoglucomutase 3) (PGM 3)

Length: 542  Mass: 59852

Tissue specificity: Found in many tissues except lung. Relatively high expression in pancreas, heart, liver, and placenta, and relatively low expression in brain, skeletal muscle and kidney. {ECO

Sequence MDLGAITKYSALHAKPNGLILQYGTAGFRTKAEHLDHVMFRMGLLAVLRSKQTKSTIGVMVTASHNPEEDNGVKL
VDPLGEMLAPSWEEHATCLANAEEQDMQRVLIDISEKEAVNLQQDAFVVIGRDTRPSSEKLSQSVIDGVTVLGGQ
FHDYGLLTTPQLHYMVYCRNTGGRYGKATIEGYYQKLSKAFVELTKQASCSGDEYRSLKVDCANGIGALKLREME
HYFSQGLSVQLFNDGSKGKLNHLCGADFVKSHQKPPQGMEIKSNERCCSFDGDADRIVYYYHDADGHFHLIDGDK
IATLISSFLKELLVEIGESLNIGVVQTAYANGSSTRYLEEVMKVPVYCTKTGVKHLHHKAQEFDIGVYFEANGHG
TALFSTAVEMKIKQSAEQLEDKKRKAAKMLENIIDLFNQAAGDAISDMLVIEAILALKGLTVQQWDALYTDLPNR
QLKVQVADRRVISTTDAERQAVTPPGLQEAINDLVKKYKLSRAFVRPSGTEDVVRVYAEADSQESADHLAHEVSL
AVFQLAGGIGERPQPGF
Structural information
Interpro:  IPR005844  IPR016055  IPR005843  IPR036900  IPR016066  
IPR016657  
Prosite:   PS00710
CDD:   cd03086
STRING:   ENSP00000425809
Other Databases GeneCards:  PGM3  Malacards:  PGM3

Gene ontology

Expand All | Collapse All

GO accessionTerm nameEvidence codeGo category
GO:0004610 phosphoacetylglucosamine
mutase activity
IBA molecular function
GO:0006048 UDP-N-acetylglucosamine b
iosynthetic process
IBA biological process
GO:0030097 hemopoiesis
IBA biological process
GO:0006048 UDP-N-acetylglucosamine b
iosynthetic process
IMP biological process
GO:0004610 phosphoacetylglucosamine
mutase activity
IMP molecular function
GO:0006493 protein O-linked glycosyl
ation
IMP biological process
GO:0006487 protein N-linked glycosyl
ation
IMP biological process
GO:0000287 magnesium ion binding
IEA molecular function
GO:0004610 phosphoacetylglucosamine
mutase activity
IEA molecular function
GO:0005975 carbohydrate metabolic pr
ocess
IEA biological process
GO:0016868 intramolecular transferas
e activity, phosphotransf
erases
IEA molecular function
GO:0071704 organic substance metabol
ic process
IEA biological process
GO:0005975 carbohydrate metabolic pr
ocess
IEA biological process
GO:0046872 metal ion binding
IEA molecular function
GO:0016853 isomerase activity
IEA molecular function
GO:0004610 phosphoacetylglucosamine
mutase activity
IEA molecular function
GO:0004610 phosphoacetylglucosamine
mutase activity
TAS molecular function
GO:0005829 cytosol
TAS cellular component
GO:0006048 UDP-N-acetylglucosamine b
iosynthetic process
TAS biological process
GO:0007283 spermatogenesis
IEA biological process
GO:0006048 UDP-N-acetylglucosamine b
iosynthetic process
IEA biological process
GO:0004610 phosphoacetylglucosamine
mutase activity
IEA molecular function
GO:0030097 hemopoiesis
IEA biological process
GO:0019255 glucose 1-phosphate metab
olic process
IEA biological process
GO:0004614 phosphoglucomutase activi
ty
IEA molecular function
GO:0006048 UDP-N-acetylglucosamine b
iosynthetic process
IEA biological process
GO:0004610 phosphoacetylglucosamine
mutase activity
IDA molecular function
GO:0006041 glucosamine metabolic pro
cess
NAS biological process
GO:0005575 cellular_component
ND cellular component

KEGG pathways

Expand All | Collapse All

Pathway idPathway name
hsa01100Metabolic pathways
hsa00520Amino sugar and nucleotide sugar metabolism
Associated diseases References
Hyper-IgE syndrome KEGG:H01968
Hyper-IgE syndrome KEGG:H01968
Teratoma PMID:5259759
cervical cancer PMID:508567
Aberrant CpGs in Low Motility Sperm MIK: 21674046
Teratozoospermia MIK: 17327269

PubMed references

Expand All | Collapse All

PMID Condition Mutation Ethnicity Population details Infertility_type Associated_genes Abstract
17327269 Teratozoos
permia

13 (5 controls,
8 cases)
Male infertility GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
Show abstract
17327269 Teratozoos
permia

19 (6 controls
, 13 cases)
Male infertility GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
Show abstract
21674046 Aberrant C
pGs in Low
Motility
Sperm

18
Male infertility GSE26881
Show abstract