• Gene id: 5232

Gene Summary

• Gene Symbol: PGK2   Gene   UCSC   Ensembl
• Aliases: HEL-S-272, PGKB, PGKPS, dJ417L20.2
• Gene name: phosphoglycerate kinase 2
• Alternate names: phosphoglycerate kinase 2, epididymis secretory protein Li 272, phosphoglycerate kinase autosomal pseudogene, phosphoglycerate kinase, testis specific, testicular tissue protein Li 139,
• Gene location: 6p12.3 (49787339: 49785650)     Exons: 1     NC_000006.12
• Gene summary(Entrez): This gene is intronless, arose via retrotransposition of the phosphoglycerate kinase 1 gene, and is expressed specifically in the testis. Initially assumed to be a pseudogene, the encoded protein is actually a functional phosphoglycerate kinase that catal
• OMIM: 172270

Protein Summary

• Protein general information: P07205  
  • Name: Phosphoglycerate kinase 2 (EC 2.7.2.3) (Phosphoglycerate kinase, testis specific)
  • Length: 417  
  • Mass: 44,796
• Sequence:

  MSLSKKLTLDKLDVRGKRVIMRVDFNVPMKKNQITNNQRIKASIPSIKYCLDNGAKAVVLMSHLGRPDGVPMPDK
  YSLAPVAVELKSLLGKDVLFLKDCVGAEVEKACANPAPGSVILLENLRFHVEEEGKGQDPSGKKIKAEPDKIEAF
  RASLSKLGDVYVNDAFGTAHRAHSSMVGVNLPHKASGFLMKKELDYFAKALENPVRPFLAILGGAKVADKIQLIK
  NMLDKVNEMIIGGGMAYTFLKVLNNMEIGASLFDEEGAKIVKDIMAKAQKNGVRITFPVDFVTGDKFDENAQVGK
  ATVASGISPGWMGLDCGPESNKNHAQVVAQARLIVWNGPLGVFEWDAFAKGTKALMDEIVKATSKGCITVIGGGD
  TATCCAKWNTEDKVSHVSTGGGASLELLEGKILPGVEALSNM

• Structural information:
  • Interpro: IPR001576  IPR015911  IPR015824  IPR036043  
  • Prosite: PS00111
  • CDD: cd00318
  • STRING: ENSP00000305995
• Other Databases: GeneCards:  PGK2  Malacards:  PGK2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0004618	phosphoglycerate kinase activity	ISS	molecular function
GO:0004618	phosphoglycerate kinase activity	NAS	molecular function
GO:0005524	ATP binding	ISS	molecular function
GO:0005634	nucleus	IDA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0006096	glycolytic process	IEA	biological process
GO:0006096	glycolytic process	NAS	biological process
GO:0016310	phosphorylation	ISS	biological process
GO:0016310	phosphorylation	NAS	biological process
GO:0030317	flagellated sperm motility	IEA	biological process
GO:0035686	sperm fibrous sheath	IEA	cellular component
GO:0070062	extracellular exosome	IDA	cellular component
GO:0098779	mitophagy in response to mitochondrial depolarization	IGI	biological process
GO:0000166	nucleotide binding	IEA	molecular function
GO:0004618	phosphoglycerate kinase activity	IEA	molecular function
GO:0004618	phosphoglycerate kinase activity	IEA	molecular function
GO:0004618	phosphoglycerate kinase activity	IEA	molecular function
GO:0004618	phosphoglycerate kinase activity	ISS	molecular function
GO:0004618	phosphoglycerate kinase activity	NAS	molecular function
GO:0005524	ATP binding	ISS	molecular function
GO:0005524	ATP binding	IEA	molecular function
GO:0005634	nucleus	IDA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005929	cilium	IEA	cellular component
GO:0006096	glycolytic process	IEA	biological process
GO:0006096	glycolytic process	IEA	biological process
GO:0006096	glycolytic process	IEA	biological process
GO:0006096	glycolytic process	IEA	biological process
GO:0006096	glycolytic process	NAS	biological process
GO:0016301	kinase activity	IEA	molecular function
GO:0016310	phosphorylation	ISS	biological process
GO:0016310	phosphorylation	IEA	biological process
GO:0016310	phosphorylation	NAS	biological process
GO:0016740	transferase activity	IEA	molecular function
GO:0030317	flagellated sperm motility	IEA	biological process
GO:0035686	sperm fibrous sheath	IEA	cellular component
GO:0070062	extracellular exosome	IDA	cellular component
GO:0098779	mitophagy in response to mitochondrial depolarization	IGI	biological process
GO:0004618	phosphoglycerate kinase activity	ISS	molecular function
GO:0004618	phosphoglycerate kinase activity	NAS	molecular function
GO:0005524	ATP binding	ISS	molecular function
GO:0005634	nucleus	IDA	cellular component
GO:0006096	glycolytic process	NAS	biological process
GO:0016310	phosphorylation	ISS	biological process
GO:0016310	phosphorylation	NAS	biological process
GO:0070062	extracellular exosome	IDA	cellular component
GO:0098779	mitophagy in response to mitochondrial depolarization	IGI	biological process

KEGG pathways

Pathway id	Pathway name
hsa01100	Metabolic pathways
hsa01200	Carbon metabolism
hsa01230	Biosynthesis of amino acids
hsa04066	HIF-1 signaling pathway

Diseases

Associated diseases	References
Male factor infertility	MIK: 25355644
Asthenozoospermia	MIK: 26677959
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Asthenozoospermia	MIK: 26677959
Hypospermatogenesis	MIK: 28361989
Asthenozoospermia	MIK: 23455884
Male infertility	MIK: 25355644
Non obstructive azoospermia	MIK: 24012201
Sertoli cell only syndrome	MIK: 23869807
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
23455884	Idiopathic asthenozoospermia				Male infertility	GRP78 lactoferrin SPANXB PGK2 flagellin DJ-1 XPA binding protein 2 CAB2 GPX4 and GAPDH
25355644	Male infertility				Male infertility	SEMG1 PIP GAPDHS PGK2
26677959	Asthenozoospermia			90 (30 healthy young males (aged 28-31 years), 30 elderly men (aged 68-70 years), and 30 asthenozoospermic patients (aged 25-40 years, progressive motility <32%))	Male infertility	PGK1 PGK2
29528137	Nonobstructive azoospermia			21 (14 nonobstructive azoospermic men (N = 4; normal FSH and normal testicular volume and N = 10; high FSH and small testicular volume), seven normozoospermic men)	Male infertility
24012201	Non obstructive azoospermia			31 (4 controls, 27 cases)	Male infertility	GSE45885 analyzed by GEO2R (cutoff 1.5 fold)
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
23869807	Non obstructive azoospermia, Sertoli cell only syndrome			20 (4 controls, 16 cases)	Male infertility	GSE45887 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28361989	Hypospermatogenesis			6 (3 controls, 3 Klienfelter syndrome	Male infertility	Microarray