• Gene id: 5230

Gene Summary

• Gene Symbol: PGK1   Gene   UCSC   Ensembl
• Aliases: HEL-S-68p, MIG10, PGKA
• Gene name: phosphoglycerate kinase 1
• Alternate names: phosphoglycerate kinase 1, PRP 2, cell migration-inducing gene 10 protein, epididymis secretory sperm binding protein Li 68p, primer recognition protein 2,
• Gene location: Xq21.1 (78104168: 78126826)     Exons: 11     NC_000023.11
• Gene summary(Entrez): The protein encoded by this gene is a glycolytic enzyme that catalyzes the conversion of 1,3-diphosphoglycerate to 3-phosphoglycerate. The encoded protein may also act as a cofactor for polymerase alpha. Additionally, this protein is secreted by tumor cel
• OMIM: 311800

Protein Summary

• Protein general information: P00558  
  • Name: Phosphoglycerate kinase 1 (EC 2.7.2.3) (Cell migration inducing gene 10 protein) (Primer recognition protein 2) (PRP 2)
  • Length: 417  
  • Mass: 44,615
• Sequence:

  MSLSNKLTLDKLDVKGKRVVMRVDFNVPMKNNQITNNQRIKAAVPSIKFCLDNGAKSVVLMSHLGRPDGVPMPDK
  YSLEPVAVELKSLLGKDVLFLKDCVGPEVEKACANPAAGSVILLENLRFHVEEEGKGKDASGNKVKAEPAKIEAF
  RASLSKLGDVYVNDAFGTAHRAHSSMVGVNLPQKAGGFLMKKELNYFAKALESPERPFLAILGGAKVADKIQLIN
  NMLDKVNEMIIGGGMAFTFLKVLNNMEIGTSLFDEEGAKIVKDLMSKAEKNGVKITLPVDFVTADKFDENAKTGQ
  ATVASGIPAGWMGLDCGPESSKKYAEAVTRAKQIVWNGPVGVFEWEAFARGTKALMDEVVKATSRGCITIIGGGD
  TATCCAKWNTEDKVSHVSTGGGASLELLEGKVLPGVDALSNI

• Structural information:
  • Interpro: IPR001576  IPR015911  IPR015824  IPR036043  
  • Prosite: PS00111
  • CDD: cd00318
  • PDB: 2WZB 2WZC 2WZD 2X13 2X14 2X15 2XE6 2XE7 2XE8 2Y3I 2YBE 2ZGV 3C39 3C3A 3C3B 3C3C 3ZOZ 4AXX 4O33 5M1R 5M3U 5M6Z 5MXM
  • PDBsum: 2WZB 2WZC 2WZD 2X13 2X14 2X15 2XE6 2XE7 2XE8 2Y3I 2YBE 2ZGV 3C39 3C3A 3C3B 3C3C 3ZOZ 4AXX 4O33 5M1R 5M3U 5M6Z 5MXM
  • DIP: 33679
  • STRING: ENSP00000362413
• Other Databases: GeneCards:  PGK1  Malacards:  PGK1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0004618	phosphoglycerate kinase activity	ISS	molecular function
GO:0004618	phosphoglycerate kinase activity	EXP	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005524	ATP binding	ISS	molecular function
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0006094	gluconeogenesis	TAS	biological process
GO:0016020	membrane	IDA	cellular component
GO:0016310	phosphorylation	ISS	biological process
GO:0030855	epithelial cell differentiation	IEP	biological process
GO:0045121	membrane raft	IDA	cellular component
GO:0061621	canonical glycolysis	TAS	biological process
GO:0070062	extracellular exosome	IDA	cellular component
GO:0070062	extracellular exosome	IDA	cellular component
GO:0070062	extracellular exosome	IDA	cellular component
GO:0070062	extracellular exosome	IDA	cellular component
GO:0070062	extracellular exosome	IDA	cellular component
GO:0000166	nucleotide binding	IEA	molecular function
GO:0004618	phosphoglycerate kinase activity	IEA	molecular function
GO:0004618	phosphoglycerate kinase activity	IEA	molecular function
GO:0004618	phosphoglycerate kinase activity	ISS	molecular function
GO:0004618	phosphoglycerate kinase activity	EXP	molecular function
GO:0004618	phosphoglycerate kinase activity	TAS	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005524	ATP binding	ISS	molecular function
GO:0005524	ATP binding	IEA	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0006094	gluconeogenesis	TAS	biological process
GO:0006096	glycolytic process	IEA	biological process
GO:0006096	glycolytic process	IEA	biological process
GO:0006096	glycolytic process	IEA	biological process
GO:0016020	membrane	IDA	cellular component
GO:0016301	kinase activity	IEA	molecular function
GO:0016310	phosphorylation	ISS	biological process
GO:0016310	phosphorylation	IEA	biological process
GO:0016740	transferase activity	IEA	molecular function
GO:0030855	epithelial cell differentiation	IEP	biological process
GO:0045121	membrane raft	IDA	cellular component
GO:0061621	canonical glycolysis	TAS	biological process
GO:0070062	extracellular exosome	IDA	cellular component
GO:0070062	extracellular exosome	IDA	cellular component
GO:0070062	extracellular exosome	IDA	cellular component
GO:0070062	extracellular exosome	IDA	cellular component
GO:0070062	extracellular exosome	IDA	cellular component
GO:0004618	phosphoglycerate kinase activity	ISS	molecular function
GO:0004618	phosphoglycerate kinase activity	EXP	molecular function
GO:0004618	phosphoglycerate kinase activity	TAS	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005524	ATP binding	ISS	molecular function
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0006094	gluconeogenesis	TAS	biological process
GO:0016020	membrane	IDA	cellular component
GO:0016310	phosphorylation	ISS	biological process
GO:0030855	epithelial cell differentiation	IEP	biological process
GO:0045121	membrane raft	IDA	cellular component
GO:0061621	canonical glycolysis	TAS	biological process
GO:0070062	extracellular exosome	IDA	cellular component
GO:0070062	extracellular exosome	IDA	cellular component
GO:0070062	extracellular exosome	IDA	cellular component
GO:0070062	extracellular exosome	IDA	cellular component
GO:0070062	extracellular exosome	IDA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa01100	Metabolic pathways
hsa01200	Carbon metabolism
hsa01230	Biosynthesis of amino acids
hsa04066	HIF-1 signaling pathway

Diseases

Associated diseases	References
Cancer (prostate)	GAD: 11745195
Cancer	GAD: 11745195
Anemia	KEGG: H00664
Asthenozoospermia	MIK: 26677959
Asthenozoospermia	MIK: 26677959
Cryptorchidism	MIK: 28606200
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
26677959	Asthenozoospermia			90 (30 healthy young males (aged 28-31 years), 30 elderly men (aged 68-70 years), and 30 asthenozoospermic patients (aged 25-40 years, progressive motility <32%))	Male infertility	PGK1 PGK2
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq