• Gene id: 5229

Gene Summary

• Gene Symbol: PGGT1B   Gene   UCSC   Ensembl
• Aliases: BGGI, GGTI
• Gene name: protein geranylgeranyltransferase type I subunit beta
• Alternate names: geranylgeranyl transferase type-1 subunit beta, CTC-428G20.3, GGTase-I-beta, geranylgeranyl transferase type I subunit beta, geranylgeranyltransferase type I beta subunit, protein geranylgeranyltransferase type I, beta subunit, type I protein geranyl-geranyltra,
• Gene location: 5q22.3 (115262886: 115200246)     Exons: 9     NC_000005.10
• Gene summary(Entrez): Protein geranylgeranyltransferase type I (GGTase-I) transfers a geranylgeranyl group to the cysteine residue of candidate proteins containing a C-terminal CAAX motif in which 'A' is an aliphatic amino acid and 'X' is leucine (summarized by Zhang et al., 1
• OMIM: 602031

Protein Summary

• Protein general information: P53609  
  • Name: Geranylgeranyl transferase type 1 subunit beta (EC 2.5.1.59) (Geranylgeranyl transferase type I subunit beta) (GGTase I beta) (Type I protein geranyl geranyltransferase subunit beta)
  • Length: 377  
  • Mass: 42368
• Sequence:

  MAATEDERLAGSGEGERLDFLRDRHVRFFQRCLQVLPERYSSLETSRLTIAFFALSGLDMLDSLDVVNKDDIIEW
  IYSLQVLPTEDRSNLNRCGFRGSSYLGIPFNPSKAPGTAHPYDSGHIAMTYTGLSCLVILGDDLSRVNKEACLAG
  LRALQLEDGSFCAVPEGSENDMRFVYCASCICYMLNNWSGMDMKKAITYIRRSMSYDNGLAQGAGLESHGGSTFC
  GIASLCLMGKLEEVFSEKELNRIKRWCIMRQQNGYHGRPNKPVDTCYSFWVGATLKLLKIFQYTNFEKNRNYILS
  TQDRLVGGFAKWPDSHPDALHAYFGICGLSLMEESGICKVHPALNVSTRTSERLLDLHQSWKTKDSKQCSENVHI
  ST

• Structural information:
  • Interpro: IPR041960  IPR001330  IPR008930  
  • CDD: cd02895
  • STRING: ENSP00000404676
• Other Databases: GeneCards:  PGGT1B  Malacards:  PGGT1B

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0018342	protein prenylation	IBA	biological process
GO:0018344	protein geranylgeranylation	IBA	biological process
GO:0005953	CAAX-protein geranylgeranyltransferase complex	IBA	cellular component
GO:0004662	CAAX-protein geranylgeranyltransferase activity	IBA	contributes to
GO:0004661	protein geranylgeranyltransferase activity	IDA	molecular function
GO:0018344	protein geranylgeranylation	IDA	biological process
GO:0005953	CAAX-protein geranylgeranyltransferase complex	IDA	cellular component
GO:0008270	zinc ion binding	ISS	molecular function
GO:0004662	CAAX-protein geranylgeranyltransferase activity	ISS	molecular function
GO:0004661	protein geranylgeranyltransferase activity	IEA	molecular function
GO:0003824	catalytic activity	IEA	molecular function
GO:0005953	CAAX-protein geranylgeranyltransferase complex	IEA	cellular component
GO:0018344	protein geranylgeranylation	IEA	biological process
GO:0046872	metal ion binding	IEA	molecular function
GO:0016740	transferase activity	IEA	molecular function
GO:0004659	prenyltransferase activity	IEA	molecular function
GO:0004662	CAAX-protein geranylgeranyltransferase activity	TAS	molecular function
GO:0005953	CAAX-protein geranylgeranyltransferase complex	TAS	cellular component
GO:0018344	protein geranylgeranylation	TAS	biological process
GO:0004662	CAAX-protein geranylgeranyltransferase activity	IEA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0042277	peptide binding	IEA	molecular function
GO:0018344	protein geranylgeranylation	IEA	biological process
GO:0008144	drug binding	IEA	molecular function
GO:0005953	CAAX-protein geranylgeranyltransferase complex	IEA	cellular component
GO:0004662	CAAX-protein geranylgeranyltransferase activity	IEA	molecular function
GO:0051771	negative regulation of nitric-oxide synthase biosynthetic process	IEA	biological process
GO:0045787	positive regulation of cell cycle	IEA	biological process
GO:0034097	response to cytokine	IEA	biological process
GO:0019840	isoprenoid binding	IEA	molecular function
GO:0008284	positive regulation of cell population proliferation	IEA	biological process
GO:0008270	zinc ion binding	IEA	molecular function

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881