• Gene id: 5228

Gene Summary

• Gene Symbol: PGF   Gene   UCSC   Ensembl
• Aliases: D12S1900, PGFL, PIGF, PLGF, PlGF-2, SHGC-10760
• Gene name: placental growth factor
• Alternate names: placenta growth factor, placental growth factor, vascular endothelial growth factor-related protein,
• Gene location: 14q24.3 (74955763: 74941829)     Exons: 7     NC_000014.9
• Gene summary(Entrez): This gene encodes a growth factor found in placenta which is homologous to vascular endothelial growth factor. Alternatively spliced transcripts encoding different isoforms have been found for this gene.[provided by RefSeq, Jun 2011]
• OMIM: 601121

Protein Summary

• Protein general information: P49763  
  • Name: Placenta growth factor (PlGF)
  • Length: 221  
  • Mass: 24,789
• Sequence:

  MPVMRLFPCFLQLLAGLALPAVPPQQWALSAGNGSSEVEVVPFQEVWGRSYCRALERLVDVVSEYPSEVEHMFSP
  SCVSLLRCTGCCGDENLHCVPVETANVTMQLLKIRSGDRPSYVELTFSQHVRCECRHSPGRQSPDMPGDFRADAP
  SFLPPRRSLPMLFRMEWGCALTGSQSAVWPSSPVPEEIPRMHPGRNGKKQQRKPLREKMKPERCGDAVPRR

• Structural information:
  • Interpro: IPR029034  IPR023581  IPR000072  
  • Prosite: PS00249 PS50278
  • CDD: cd00135
  • PDB: 1FZV 1RV6
  • PDBsum: 1FZV 1RV6
  • DIP: 5752
  • STRING: ENSP00000451040
• Other Databases: GeneCards:  PGF  Malacards:  PGF

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0001658	branching involved in ureteric bud morphogenesis	IEA	biological process
GO:0001666	response to hypoxia	IEA	biological process
GO:0001938	positive regulation of endothelial cell proliferation	IEA	biological process
GO:0002040	sprouting angiogenesis	IEA	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005615	extracellular space	IEA	cellular component
GO:0007165	signal transduction	TAS	biological process
GO:0007267	cell-cell signaling	TAS	biological process
GO:0007565	female pregnancy	IEA	biological process
GO:0008083	growth factor activity	IMP	molecular function
GO:0008201	heparin binding	IEA	molecular function
GO:0008284	positive regulation of cell proliferation	IMP	biological process
GO:0016020	membrane	IEA	cellular component
GO:0030154	cell differentiation	IEA	biological process
GO:0031100	animal organ regeneration	IEA	biological process
GO:0032870	cellular response to hormone stimulus	IEA	biological process
GO:0042493	response to drug	IEA	biological process
GO:0042803	protein homodimerization activity	IEA	molecular function
GO:0045766	positive regulation of angiogenesis	IEA	biological process
GO:0046982	protein heterodimerization activity	IEA	molecular function
GO:0048010	vascular endothelial growth factor receptor signaling pathway	TAS	biological process
GO:0051781	positive regulation of cell division	IEA	biological process
GO:0060688	regulation of morphogenesis of a branching structure	IEA	biological process
GO:0001525	angiogenesis	IEA	biological process
GO:0001658	branching involved in ureteric bud morphogenesis	IEA	biological process
GO:0001666	response to hypoxia	IEA	biological process
GO:0001938	positive regulation of endothelial cell proliferation	IEA	biological process
GO:0002040	sprouting angiogenesis	IEA	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005576	extracellular region	IEA	cellular component
GO:0005576	extracellular region	IEA	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005615	extracellular space	IEA	cellular component
GO:0007165	signal transduction	TAS	biological process
GO:0007267	cell-cell signaling	TAS	biological process
GO:0007275	multicellular organism development	IEA	biological process
GO:0007565	female pregnancy	IEA	biological process
GO:0008083	growth factor activity	IEA	molecular function
GO:0008083	growth factor activity	IEA	molecular function
GO:0008083	growth factor activity	IMP	molecular function
GO:0008083	growth factor activity	TAS	molecular function
GO:0008201	heparin binding	IEA	molecular function
GO:0008284	positive regulation of cell proliferation	IMP	biological process
GO:0008284	positive regulation of cell proliferation	TAS	biological process
GO:0016020	membrane	IEA	cellular component
GO:0030154	cell differentiation	IEA	biological process
GO:0031100	animal organ regeneration	IEA	biological process
GO:0032870	cellular response to hormone stimulus	IEA	biological process
GO:0042493	response to drug	IEA	biological process
GO:0042803	protein homodimerization activity	IEA	molecular function
GO:0045766	positive regulation of angiogenesis	IEA	biological process
GO:0046982	protein heterodimerization activity	IEA	molecular function
GO:0048010	vascular endothelial growth factor receptor signaling pathway	TAS	biological process
GO:0051781	positive regulation of cell division	IEA	biological process
GO:0060688	regulation of morphogenesis of a branching structure	IEA	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0007165	signal transduction	TAS	biological process
GO:0007267	cell-cell signaling	TAS	biological process
GO:0008083	growth factor activity	IMP	molecular function
GO:0008083	growth factor activity	TAS	molecular function
GO:0008284	positive regulation of cell proliferation	IMP	biological process
GO:0008284	positive regulation of cell proliferation	TAS	biological process
GO:0048010	vascular endothelial growth factor receptor signaling pathway	TAS	biological process

KEGG pathways

Pathway id	Pathway name
hsa04151	PI3K-Akt signaling pathway
hsa04510	Focal adhesion
hsa05200	Pathways in cancer

Diseases

Associated diseases	References
Hypertension	INFBASE: 23957293
Amyotrophic lateral sclerosis (ALS)	GAD: 18608101
Placenta diseases	INFBASE: 26560488
Preeclampsia	INFBASE: 19474289
Chorioamnionitis	GAD: 20673868
Chromosomally abnormal pregnancy trisomy 21, 28,18, 19, 13	MIK: 19277983
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Chromosomally abnormal pregnancy trisomy 21, 28,18, 19, 13, Turner syndrome and triploidy.	MIK: 19277983
Cryptorchidism	MIK: 28606200

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
19277983	Chromosomally abnormal pregnancy trisomy 21, 28,18, 19, 13, Turner syndrome and triploidy.	Chromosomally abnormal pregnancy trisomy 21, 28,18, 19, 13, Turner syndrome and triploidy.		784 (609 euploid, 175 chromosomally abnormal pregnancies)	Male infertility, Female infertility	PlGF PAPP-A
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq