• Gene id: 522

Gene Summary

• Gene Symbol: ATP5PF   Gene   UCSC   Ensembl
• Aliases: ATP5, ATP5A, ATP5J, ATPM, CF6, F6
• Gene name: ATP synthase peripheral stalk subunit F6
• Alternate names: ATP synthase-coupling factor 6, mitochondrial, ATP synthase, H+ transporting, mitochondrial F0 complex, subunit F6, ATP synthase, H+ transporting, mitochondrial Fo complex subunit F6, ATPase subunit F6, coupling factor 6, mitochondrial ATP synthase, coupling f,
• Gene location: 21q21.3 (25735653: 25724479)     Exons: 5     NC_000021.9
• Gene summary(Entrez): Mitochondrial ATP synthase catalyzes ATP synthesis, utilizing an electrochemical gradient of protons across the inner membrane during oxidative phosphorylation. It is composed of two linked multi-subunit complexes: the soluble catalytic core, F1, and the
• OMIM: 603152

Protein Summary

• Protein general information: P18859  
  • Name: ATP synthase coupling factor 6, mitochondrial (ATPase subunit F6) (ATP synthase peripheral stalk subunit F6)
  • Length: 108  
  • Mass: 12588
• Sequence:

  MILQRLFRFSSVIRSAVSVHLRRNIGVTAVAFNKELDPIQKLFVDKIREYKSKRQTSGGPVDASSEYQQELEREL
  FKLKQMFGNADMNTFPTFKFEDPKFEVIEKPQA

• Structural information:
  • Interpro: IPR008387  IPR036204  
  • STRING: ENSP00000389649
• Other Databases: GeneCards:  ATP5PF  Malacards:  ATP5PF

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005753	mitochondrial proton-transporting ATP synthase complex	IBA	cellular component
GO:0015986	ATP synthesis coupled proton transport	IEA	biological process
GO:0000276	mitochondrial proton-transporting ATP synthase complex, coupling factor F(o)	IEA	cellular component
GO:0015078	proton transmembrane transporter activity	IEA	molecular function
GO:0016020	membrane	IEA	cellular component
GO:0006811	ion transport	IEA	biological process
GO:0005739	mitochondrion	IEA	cellular component
GO:0045263	proton-transporting ATP synthase complex, coupling factor F(o)	IEA	cellular component
GO:0005743	mitochondrial inner membrane	IEA	cellular component
GO:0005739	mitochondrion	TAS	cellular component
GO:0005743	mitochondrial inner membrane	TAS	cellular component
GO:0005743	mitochondrial inner membrane	TAS	cellular component
GO:0005743	mitochondrial inner membrane	TAS	cellular component
GO:0005743	mitochondrial inner membrane	TAS	cellular component
GO:0042407	cristae formation	TAS	biological process
GO:0006754	ATP biosynthetic process	TAS	biological process
GO:0006754	ATP biosynthetic process	TAS	biological process
GO:0042776	mitochondrial ATP synthesis coupled proton transport	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0000276	mitochondrial proton-transporting ATP synthase complex, coupling factor F(o)	IEA	cellular component
GO:0005739	mitochondrion	IEA	cellular component
GO:0005753	mitochondrial proton-transporting ATP synthase complex	IEA	cellular component
GO:0009986	cell surface	IEA	cellular component
GO:0016887	ATPase activity	IEA	molecular function
GO:0032307	negative regulation of prostaglandin secretion	IEA	biological process
GO:0044877	protein-containing complex binding	IEA	molecular function
GO:1900139	negative regulation of arachidonic acid secretion	IEA	biological process
GO:0005615	extracellular space	IEA	cellular component
GO:0010460	positive regulation of heart rate	IEA	biological process
GO:0014850	response to muscle activity	IEA	biological process
GO:0045777	positive regulation of blood pressure	IEA	biological process
GO:0046034	ATP metabolic process	IEA	biological process
GO:0005739	mitochondrion	IEA	cellular component
GO:0005743	mitochondrial inner membrane	IEA	cellular component
GO:0005739	mitochondrion	IDA	cellular component
GO:0021762	substantia nigra development	HEP	biological process
GO:0042776	mitochondrial ATP synthesis coupled proton transport	IDA	biological process
GO:0005753	mitochondrial proton-transporting ATP synthase complex	IDA	cellular component
GO:0046933	proton-transporting ATP synthase activity, rotational mechanism	IDA	contributes to
GO:0005739	mitochondrion	HDA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa01100	Metabolic pathways
hsa05010	Alzheimer disease
hsa05016	Huntington disease
hsa05012	Parkinson disease
hsa04714	Thermogenesis
hsa00190	Oxidative phosphorylation

Diseases

Associated diseases	References
Essential hypertension	PMID:14654753
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Male factor infertility	MIK: 29961538
Teratozoospermia	MIK: 17327269
Unexplained infertility	MIK: 25753583

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
25753583	Unexplained infertility			46 (17 fertile men, 29 male patients)	Male infertility	Microarray