• Gene id: 5203

Gene Summary

• Gene Symbol: PFDN4   Gene   UCSC   Ensembl
• Aliases: C1, PFD4
• Gene name: prefoldin subunit 4
• Alternate names: prefoldin subunit 4, prefoldin 4, protein C-1,
• Gene location: 20q13.2 (54208086: 54219960)     Exons: 5     NC_000020.11
• Gene summary(Entrez): This gene encodes a member of the prefoldin beta subunit family. The encoded protein is one of six subunits of prefoldin, a molecular chaperone complex that binds and stabilizes newly synthesized polypeptides, thereby allowing them to fold correctly. The
• OMIM: 604898

Protein Summary

• Protein general information: Q9NQP4  
  • Name: Prefoldin subunit 4 (Protein C 1)
  • Length: 134  
  • Mass: 15314
• Sequence:

  MAATMKKAAAEDVNVTFEDQQKINKFARNTSRITELKEEIEVKKKQLQNLEDACDDIMLADDDCLMIPYQIGDVF
  ISHSQEETQEMLEEAKKNLQEEIDALESRVESIQRVLADLKVQLYAKFGSNINLEADES

• Structural information:
  • Interpro: IPR002777  IPR016661  IPR009053  
  • PDB: 6NR8 6NR9 6NRB 6NRC 6NRD
  • PDBsum: 6NR8 6NR9 6NRB 6NRC 6NRD
  • STRING: ENSP00000360473
• Other Databases: GeneCards:  PFDN4  Malacards:  PFDN4

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005737	cytoplasm	IBA	cellular component
GO:0016272	prefoldin complex	IBA	cellular component
GO:0005739	mitochondrion	IDA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0006457	protein folding	IEA	biological process
GO:0051082	unfolded protein binding	IEA	molecular function
GO:0016272	prefoldin complex	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005739	mitochondrion	IEA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005739	mitochondrion	IEA	cellular component
GO:0006457	protein folding	TAS	biological process
GO:0005829	cytosol	NAS	cellular component
GO:0051087	chaperone binding	TAS	molecular function

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881