• Gene id: 5201

Gene Summary

• Gene Symbol: PFDN1   Gene   UCSC   Ensembl
• Aliases: PDF, PFD1
• Gene name: prefoldin subunit 1
• Alternate names: prefoldin subunit 1, prefoldin 1,
• Gene location: 5q31.3 (140303100: 140245034)     Exons: 5     NC_000005.10
• Gene summary(Entrez): This gene encodes a member of the prefoldin beta subunit family. The encoded protein is one of six subunits of prefoldin, a molecular chaperone complex that binds and stabilizes newly synthesized polypeptides, thereby allowing them to fold correctly. The
• OMIM: 0

Protein Summary

• Protein general information: O60925  
  • Name: Prefoldin subunit 1
  • Length: 122  
  • Mass: 14210
• Sequence:

  MAAPVDLELKKAFTELQAKVIDTQQKVKLADIQIEQLNRTKKHAHLTDTEIMTLVDETNMYEGVGRMFILQSKEA
  IHSQLLEKQKIAEEKIKELEQKKSYLERSVKEAEDNIREMLMARRAQ

• Structural information:
  • Interpro: IPR002777  IPR009053  
  • PDB: 6NR8 6NR9 6NRB 6NRC 6NRD
  • PDBsum: 6NR8 6NR9 6NRB 6NRC 6NRD
  • STRING: ENSP00000261813
• Other Databases: GeneCards:  PFDN1  Malacards:  PFDN1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0051082	unfolded protein binding	IBA	molecular function
GO:0006457	protein folding	IBA	biological process
GO:0044183	protein folding chaperone	IBA	molecular function
GO:0005737	cytoplasm	IBA	cellular component
GO:0006457	protein folding	IEA	biological process
GO:0051082	unfolded protein binding	IEA	molecular function
GO:0016272	prefoldin complex	IEA	cellular component
GO:0044183	protein folding chaperone	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881