• Gene id: 5197

Gene Summary

• Gene Symbol: PF4V1   Gene   UCSC   Ensembl
• Aliases: CXCL4L1, CXCL4V1, PF4-ALT, PF4A, SCYB4V1
• Gene name: platelet factor 4 variant 1
• Alternate names: platelet factor 4 variant, C-X-C motif chemokine 4, PF4alt, PF4var1, platelet factor 4, variant 1 (PF4-like),
• Gene location: 4q13.3 (73853295: 73854482)     Exons: 3     NC_000004.12
• Gene summary(Entrez): The protein encoded by this gene is a chemokine that is highly similar to platelet factor 4. The encoded protein displays a strong antiangiogenic function and is regulated by chemokine (C-X-C motif) receptor 3. This protein also impairs tumor growth and c
• OMIM: 142967

Protein Summary

• Protein general information: P10720  
  • Name: Platelet factor 4 variant (C X C motif chemokine 4 variant) (CXCL4L1) (PF4alt) (PF4var1) [Cleaved into: Platelet factor 4 variant(4 74); Platelet factor 4 variant(5 74); Platelet factor 4 variant(6 74)]
  • Length: 104  
  • Mass: 11553
• Sequence:

  MSSAARSRLTRATRQEMLFLALLLLPVVVAFARAEAEEDGDLQCLCVKTTSQVRPRHITSLEVIKAGPHCPTAQL
  IATLKNGRKICLDLQALLYKKIIKEHLES

• Structural information:
  • Interpro: IPR001089  IPR018048  IPR001811  IPR033899  IPR036048   IPR027222  
  • Prosite: PS00471
  • CDD: cd00273
  • PDB: 4HSV
  • PDBsum: 4HSV
  • STRING: ENSP00000226524
• Other Databases: GeneCards:  PF4V1  Malacards:  PF4V1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005615	extracellular space	IBA	cellular component
GO:0008009	chemokine activity	IBA	molecular function
GO:0030593	neutrophil chemotaxis	IBA	biological process
GO:0061844	antimicrobial humoral immune response mediated by antimicrobial peptide	IBA	biological process
GO:0070098	chemokine-mediated signaling pathway	IBA	biological process
GO:0071222	cellular response to lipopolysaccharide	IBA	biological process
GO:0006954	inflammatory response	IBA	biological process
GO:0006955	immune response	IBA	biological process
GO:0030595	leukocyte chemotaxis	IBA	biological process
GO:0045236	CXCR chemokine receptor binding	IBA	molecular function
GO:0005576	extracellular region	IEA	cellular component
GO:0006952	defense response	IEA	biological process
GO:0008009	chemokine activity	IEA	molecular function
GO:0030168	platelet activation	IEA	biological process
GO:0006935	chemotaxis	IEA	biological process
GO:0006955	immune response	IEA	biological process
GO:0008201	heparin binding	IEA	molecular function
GO:0030595	leukocyte chemotaxis	IEA	biological process
GO:0005615	extracellular space	IEA	cellular component
GO:0005125	cytokine activity	IEA	molecular function
GO:0005576	extracellular region	IEA	cellular component
GO:0008201	heparin binding	IEA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005576	extracellular region	IEA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa04060	Cytokine-cytokine receptor interaction
hsa04062	Chemokine signaling pathway
hsa04061	Viral protein interaction with cytokine and cytokine receptor

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881