• Gene id: 5196

Gene Summary

• Gene Symbol: PF4   Gene   UCSC   Ensembl
• Aliases: CXCL4, PF-4, SCYB4
• Gene name: platelet factor 4
• Alternate names: platelet factor 4, C-X-C motif chemokine 4, chemokine (C-X-C motif) ligand 4, iroplact, oncostatin-A,
• Gene location: 4q13.3 (73982123: 73980810)     Exons: 3     NC_000004.12
• Gene summary(Entrez): This gene encodes a member of the CXC chemokine family. This chemokine is released from the alpha granules of activated platelets in the form of a homotetramer which has high affinity for heparin and is involved in platelet aggregation. This protein is ch
• OMIM: 173460

Protein Summary

• Protein general information: P02776  
  • Name: Platelet factor 4 (PF 4) (C X C motif chemokine 4) (Iroplact) (Oncostatin A) [Cleaved into: Platelet factor 4, short form (Endothelial cell growth inhibitor)]
  • Length: 101  
  • Mass: 10845
• Sequence:

  MSSAAGFCASRPGLLFLGLLLLPLVVAFASAEAEEDGDLQCLCVKTTSQVRPRHITSLEVIKAGPHCPTAQLIAT
  LKNGRKICLDLQAPLYKKIIKKLLES

• Structural information:
  • Interpro: IPR001089  IPR018048  IPR001811  IPR033899  IPR036048   IPR027222  
  • Prosite: PS00471
  • CDD: cd00273
  • PDB: 1DN3 1F9Q 1F9R 1F9S 1PFM 1PFN 1RHP 4R9W 4R9Y 4RAU
  • PDBsum: 1DN3 1F9Q 1F9R 1F9S 1PFM 1PFN 1RHP 4R9W 4R9Y 4RAU
  • DIP: 56941
  • STRING: ENSP00000296029
• Other Databases: GeneCards:  PF4  Malacards:  PF4

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005615	extracellular space	IBA	cellular component
GO:0008009	chemokine activity	IBA	molecular function
GO:0030593	neutrophil chemotaxis	IBA	biological process
GO:0061844	antimicrobial humoral immune response mediated by antimicrobial peptide	IBA	biological process
GO:0070098	chemokine-mediated signaling pathway	IBA	biological process
GO:0071222	cellular response to lipopolysaccharide	IBA	biological process
GO:0006954	inflammatory response	IBA	biological process
GO:0006955	immune response	IBA	biological process
GO:0030595	leukocyte chemotaxis	IBA	biological process
GO:0045236	CXCR chemokine receptor binding	IBA	molecular function
GO:0048248	CXCR3 chemokine receptor binding	IDA	molecular function
GO:0042127	regulation of cell population proliferation	IDA	biological process
GO:0007189	adenylate cyclase-activating G protein-coupled receptor signaling pathway	IDA	biological process
GO:0045944	positive regulation of transcription by RNA polymerase II	IDA	biological process
GO:0005576	extracellular region	IEA	cellular component
GO:0006952	defense response	IEA	biological process
GO:0008009	chemokine activity	IEA	molecular function
GO:0030168	platelet activation	IEA	biological process
GO:0006935	chemotaxis	IEA	biological process
GO:0006955	immune response	IEA	biological process
GO:0008201	heparin binding	IEA	molecular function
GO:0030595	leukocyte chemotaxis	IEA	biological process
GO:0005125	cytokine activity	IEA	molecular function
GO:0005576	extracellular region	IEA	cellular component
GO:0005615	extracellular space	IEA	cellular component
GO:0008201	heparin binding	IEA	molecular function
GO:0006935	chemotaxis	IEA	biological process
GO:0002576	platelet degranulation	TAS	biological process
GO:0007186	G protein-coupled receptor signaling pathway	TAS	biological process
GO:0031093	platelet alpha granule lumen	TAS	cellular component
GO:0031093	platelet alpha granule lumen	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0045652	regulation of megakaryocyte differentiation	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0010628	positive regulation of gene expression	IDA	biological process
GO:0010744	positive regulation of macrophage derived foam cell differentiation	IDA	biological process
GO:0045347	negative regulation of MHC class II biosynthetic process	IDA	biological process
GO:0045651	positive regulation of macrophage differentiation	IDA	biological process
GO:0032760	positive regulation of tumor necrosis factor production	IDA	biological process
GO:2001240	negative regulation of extrinsic apoptotic signaling pathway in absence of ligand	IDA	biological process
GO:0062023	collagen-containing extracellular matrix	HDA	cellular component
GO:0005576	extracellular region	IEA	cellular component
GO:0030168	platelet activation	IDA	biological process
GO:0016525	negative regulation of angiogenesis	IDA	biological process
GO:0030595	leukocyte chemotaxis	IDA	biological process
GO:0008201	heparin binding	IDA	molecular function
GO:0045653	negative regulation of megakaryocyte differentiation	IDA	biological process
GO:0019221	cytokine-mediated signaling pathway	IDA	biological process
GO:0051873	killing by host of symbiont cells	IDA	biological process
GO:0005737	cytoplasm	IDA	cellular component
GO:0020005	symbiont-containing vacuole membrane	IDA	cellular component
GO:0042832	defense response to protozoan	IDA	biological process
GO:0061844	antimicrobial humoral immune response mediated by antimicrobial peptide	IDA	biological process
GO:0030430	host cell cytoplasm	IDA	cellular component
GO:0008009	chemokine activity	TAS	molecular function
GO:0005576	extracellular region	NAS	cellular component

KEGG pathways

Pathway id	Pathway name
hsa04060	Cytokine-cytokine receptor interaction
hsa04062	Chemokine signaling pathway
hsa04061	Viral protein interaction with cytokine and cytokine receptor

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)