• Gene id: 5195

Gene Summary

• Gene Symbol: PEX14   Gene   UCSC   Ensembl
• Aliases: NAPP2, PBD13A, Pex14p, dJ734G22.2
• Gene name: peroxisomal biogenesis factor 14
• Alternate names: peroxisomal membrane protein PEX14, NF-E2 associated polypeptide 2, PTS1 receptor docking protein, peroxin-14, peroxisomal membrane anchor protein PEX14, peroxisomal membrane anchor protein Pex14p,
• Gene location: 1p36.22 (10474945: 10630757)     Exons: 14     NC_000001.11
• Gene summary(Entrez): This gene encodes an essential component of the peroxisomal import machinery. The protein is integrated into peroxisome membranes with its C-terminus exposed to the cytosol, and interacts with the cytosolic receptor for proteins containing a PTS1 peroxiso
• OMIM: 601791

Protein Summary

• Protein general information: O75381  
  • Name: Peroxisomal membrane protein PEX14 (PTS1 receptor docking protein) (Peroxin 14) (Peroxisomal membrane anchor protein PEX14)
  • Length: 377  
  • Mass: 41237
• Sequence:

  MASSEQAEQPSQPSSTPGSENVLPREPLIATAVKFLQNSRVRQSPLATRRAFLKKKGLTDEEIDMAFQQSGTAAD
  EPSSLGPATQVVPVQPPHLISQPYSPAGSRWRDYGALAIIMAGIAFGFHQLYKKYLLPLILGGREDRKQLERMEA
  GLSELSGSVAQTVTQLQTTLASVQELLIQQQQKIQELAHELAAAKATTSTNWILESQNINELKSEINSLKGLLLN
  RRQFPPSPSAPKIPSWQIPVKSPSPSSPAAVNHHSSSDISPVSNESTSSSPGKEGHSPEGSTVTYHLLGPQEEGE
  GVVDVKGQVRMEVQGEEEKREDKEDEEDEEDDDVSHVDEEDCLGVQREDRRGGDGQINEQVEKLRRPEGASNESE
  RD

• Structural information:
  • Interpro: IPR025655  IPR006785  IPR036388  
  • PDB: 2W84 2W85 4BXU
  • PDBsum: 2W84 2W85 4BXU
  • STRING: ENSP00000349016
• Other Databases: GeneCards:  PEX14  Malacards:  PEX14

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:1990429	peroxisomal importomer complex	IBA	cellular component
GO:0016560	protein import into peroxisome matrix, docking	IBA	biological process
GO:0005778	peroxisomal membrane	IBA	cellular component
GO:0005102	signaling receptor binding	IBA	molecular function
GO:0005777	peroxisome	IDA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005778	peroxisomal membrane	IEA	cellular component
GO:0015031	protein transport	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0005777	peroxisome	IEA	cellular component
GO:0015031	protein transport	IEA	biological process
GO:0005778	peroxisomal membrane	IDA	cellular component
GO:0005778	peroxisomal membrane	TAS	cellular component
GO:0005778	peroxisomal membrane	TAS	cellular component
GO:0005778	peroxisomal membrane	TAS	cellular component
GO:0005778	peroxisomal membrane	TAS	cellular component
GO:0005778	peroxisomal membrane	TAS	cellular component
GO:0005778	peroxisomal membrane	TAS	cellular component
GO:0005778	peroxisomal membrane	TAS	cellular component
GO:0005778	peroxisomal membrane	TAS	cellular component
GO:0005778	peroxisomal membrane	TAS	cellular component
GO:0005778	peroxisomal membrane	TAS	cellular component
GO:0016567	protein ubiquitination	TAS	biological process
GO:0006625	protein targeting to peroxisome	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005778	peroxisomal membrane	IEA	cellular component
GO:0005777	peroxisome	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0005778	peroxisomal membrane	IEA	cellular component
GO:0005777	peroxisome	IEA	cellular component
GO:0032991	protein-containing complex	IEA	cellular component
GO:0005778	peroxisomal membrane	IEA	cellular component
GO:0001650	fibrillar center	IDA	cellular component
GO:0005777	peroxisome	IDA	cellular component
GO:0043433	negative regulation of DNA-binding transcription factor activity	IDA	biological process
GO:0036250	peroxisome transport along microtubule	IDA	biological process
GO:0034453	microtubule anchoring	IDA	biological process
GO:0032091	negative regulation of protein binding	IDA	biological process
GO:0065003	protein-containing complex assembly	IDA	biological process
GO:0005778	peroxisomal membrane	IDA	cellular component
GO:0005778	peroxisomal membrane	IDA	cellular component
GO:0045892	negative regulation of transcription, DNA-templated	IDA	biological process
GO:0032991	protein-containing complex	IDA	cellular component
GO:0008017	microtubule binding	IDA	molecular function
GO:0044721	protein import into peroxisome matrix, substrate release	IDA	biological process
GO:0016561	protein import into peroxisome matrix, translocation	IDA	biological process
GO:0005778	peroxisomal membrane	IDA	cellular component
GO:0005777	peroxisome	IDA	cellular component
GO:0005777	peroxisome	IDA	cellular component
GO:0005777	peroxisome	IDA	cellular component
GO:0003714	transcription corepressor activity	IDA	molecular function
GO:0007031	peroxisome organization	IGI	NOT|biological process
GO:0005515	protein binding	IPI	molecular function
GO:0016020	membrane	HDA	cellular component
GO:0042802	identical protein binding	IPI	molecular function
GO:0048487	beta-tubulin binding	IPI	molecular function
GO:0005778	peroxisomal membrane	ISS	cellular component
GO:0005634	nucleus	NAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005102	signaling receptor binding	IPI	molecular function
GO:0032991	protein-containing complex	ISS	cellular component
GO:0007031	peroxisome organization	ISS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0047485	protein N-terminus binding	IPI	molecular function
GO:0016558	protein import into peroxisome matrix	IMP	biological process
GO:0016021	integral component of membrane	ISS	cellular component
GO:0005778	peroxisomal membrane	HDA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005102	signaling receptor binding	IPI	molecular function
GO:0005102	signaling receptor binding	IPI	molecular function
GO:0005102	signaling receptor binding	IPI	molecular function

KEGG pathways

Pathway id	Pathway name
hsa04146	Peroxisome

Diseases

Associated diseases	References
Peroxisome biogenesis disorder	KEGG:H00205
Zellweger syndrome	KEGG:H01342
Peroxisome biogenesis disorder	KEGG:H00205
Zellweger syndrome	KEGG:H01342
Cryptorchidism	MIK: 28606200
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq