• Gene id: 5188

Gene Summary

• Gene Symbol: GATB   Gene   UCSC   Ensembl
• Aliases: COXPD41, HSPC199, PET112, PET112L
• Gene name: glutamyl-tRNA amidotransferase subunit B
• Alternate names: glutamyl-tRNA(Gln) amidotransferase subunit B, mitochondrial, PET112 homolog, cytochrome c oxidase assembly factor PET112 homolog, cytochrome oxidase assembly factor PET112 homolog, glu-AdT subunit B, glutamyl-tRNA(Gln) amidotransferase, subunit B,
• Gene location: 4q31.3 (151761022: 151670503)     Exons: 13     NC_000004.12
• OMIM: 613946

Protein Summary

• Protein general information: O75879  
  • Name: Glutamyl tRNA(Gln) amidotransferase subunit B, mitochondrial (Glu AdT subunit B) (EC 6.3.5. ) (Cytochrome c oxidase assembly factor PET112 homolog)
  • Length: 557  
  • Mass: 61864
  • Tissue specificity: Predominantly expressed in tissues characterized by high rates of oxidative phosphorylation (OxPhos), including muscle and heart. {ECO
• Sequence:

  MAAPMLRWGCRGRRWAFARVDGGSCHRRGAPTGSTSNQIRGESSVAQQPLHTAQKTRKGEHKWAAVVGLEIHAQI
  SSNSKLFSGSQVRFSAPPNSLVSFFDASLPGTLPVLNRRCVEAAVMTGLALNCHINKKSLFDRKHYFYADLPAGY
  QITQQRLPIAVNGSLIYGVCAGKKQSQVIPKTVRIKQIQLEQDSGKSLHDNLRSQTLIDLNRAGVGLLEVVLEPD
  MSCGEEAATAVRELQLILQALGTSQANMAEGQLRVDANISVHHPGEPLGVRTEVKNLNSIRFLAKAIDYEIQRQI
  NELENGGEILNETRSFHHKLGCTMSMRDKEGKQDYRFMPEPNLPPLVLYDATSLPAGADPQQVINIDQIRETLPE
  LPSVTREKLVQQYGMLLEHSFTLLNEVGLLEFFQNVIKETRAEPKKVTSWVLNTFLGYLKQQNLAVSESPVTPSA
  LAELLDLLDSRTISSSAAKQVFEELWKREGKTPGQIVSEKQLELMQDQGALEQLCHSVMEAHPQVVMDVKNRNPR
  AINKLIGLVRKATQSRADPVMIKEILEKKLSL

• Structural information:
  • Interpro: IPR004413  IPR017959  IPR006075  IPR018027  IPR003789   IPR042114  IPR023168  IPR017958  IPR014746  
  • Prosite: PS01234
  • DIP: 48968
  • STRING: ENSP00000263985
• Other Databases: GeneCards:  GATB  Malacards:  GATB

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0070681	glutaminyl-tRNAGln biosynthesis via transamidation	IBA	biological process
GO:0032543	mitochondrial translation	IBA	biological process
GO:0050567	glutaminyl-tRNA synthase (glutamine-hydrolyzing) activity	IBA	molecular function
GO:0030956	glutamyl-tRNA(Gln) amidotransferase complex	IBA	cellular component
GO:0005739	mitochondrion	IBA	cellular component
GO:0070681	glutaminyl-tRNAGln biosynthesis via transamidation	IDA	biological process
GO:0050567	glutaminyl-tRNA synthase (glutamine-hydrolyzing) activity	IDA	molecular function
GO:0030956	glutamyl-tRNA(Gln) amidotransferase complex	IDA	cellular component
GO:0005739	mitochondrion	IDA	cellular component
GO:0032543	mitochondrial translation	IMP	biological process
GO:0016884	carbon-nitrogen ligase activity, with glutamine as amido-N-donor	IEA	molecular function
GO:0003824	catalytic activity	IEA	molecular function
GO:0016874	ligase activity	IEA	molecular function
GO:0006412	translation	IEA	biological process
GO:0005524	ATP binding	IEA	molecular function
GO:0005739	mitochondrion	IEA	cellular component
GO:0000166	nucleotide binding	IEA	molecular function
GO:0016874	ligase activity	IEA	molecular function
GO:0005739	mitochondrion	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005739	mitochondrion	IEA	cellular component
GO:0005739	mitochondrion	IEA	cellular component
GO:0005739	mitochondrion	IDA	cellular component
GO:0032543	mitochondrial translation	IEA	biological process
GO:0070681	glutaminyl-tRNAGln biosynthesis via transamidation	IEA	biological process
GO:0016884	carbon-nitrogen ligase activity, with glutamine as amido-N-donor	IEA	molecular function
GO:0050567	glutaminyl-tRNA synthase (glutamine-hydrolyzing) activity	IEA	molecular function
GO:0030956	glutamyl-tRNA(Gln) amidotransferase complex	IEA	cellular component
GO:0005739	mitochondrion	IEA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa01100	Metabolic pathways
hsa00970	Aminoacyl-tRNA biosynthesis

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881