About Us

Search Result


Gene id 51806
Gene Summary    Protein Summary    Gene ontology    KEGG pathways    Diseases    PubMed    

Gene Summary

Gene Symbol CALML5   Gene   UCSC   Ensembl
Aliases CLSP
Gene name calmodulin like 5
Alternate names calmodulin-like protein 5, calmodulin-like skin protein,
Gene location 10p15.1 (5499569: 5498696)     Exons: 1     NC_000010.11
Gene summary(Entrez) This gene encodes a novel calcium binding protein expressed in the epidermis and related to the calmodulin family of calcium binding proteins. Functional studies with recombinant protein demonstrate it does bind calcium and undergoes a conformational chan
OMIM 113725

Protein Summary

Protein general information Q9NZT1  

Name: Calmodulin like protein 5 (Calmodulin like skin protein)

Length: 146  Mass: 15893

Tissue specificity: Particularly abundant in the epidermis where its expression is directly related to keratinocyte differentiation. Very low expression in lung.

Sequence MAGELTPEEEAQYKKAFSAVDTDGNGTINAQELGAALKATGKNLSEAQLRKLISEVDSDGDGEISFQEFLTAAKK
ARAGLEDLQVAFRAFDQDGDGHITVDELRRAMAGLGQPLPQEELDAMIREADVDQDGRVNYEEFARMLAQE
Structural information
Protein Domains
(8..4-)
(/note="EF-hand-1)
(/evidence="ECO:0000255|PROSITE-ProRule:PRU00448-)
(44..7-)
(/note="EF-hand-2)
(/evidence="ECO:0000255|PROSITE-ProRule:PRU00448-)
(78..11-)
(/note="EF-hand-3)
(/evidence="ECO:0000255|PROSITE-ProRule:PRU00448-)
Interpro:  IPR011992  IPR018247  IPR002048  
Prosite:   PS00018 PS50222

PDB:  
2B1U
PDBsum:   2B1U
STRING:   ENSP00000369689
Other Databases GeneCards:  CALML5  Malacards:  CALML5

Gene ontology

Expand All | Collapse All

GO accessionTerm nameEvidence codeGo category
GO:0030234 enzyme regulator activity
IBA molecular function
GO:0005509 calcium ion binding
IBA molecular function
GO:0019722 calcium-mediated signalin
g
IBA biological process
GO:0000226 microtubule cytoskeleton
organization
IBA biological process
GO:0005509 calcium ion binding
IEA molecular function
GO:0046872 metal ion binding
IEA molecular function
GO:0005509 calcium ion binding
TAS molecular function
GO:0007165 signal transduction
TAS biological process
GO:0008544 epidermis development
TAS biological process
GO:0043312 neutrophil degranulation
TAS biological process
GO:1904813 ficolin-1-rich granule lu
men
TAS cellular component
GO:0005576 extracellular region
TAS cellular component
GO:0050790 regulation of catalytic a
ctivity
IEA biological process

KEGG pathways

Expand All | Collapse All

Pathway idPathway name
hsa05200Pathways in cancer
hsa05010Alzheimer disease
hsa05012Parkinson disease
hsa04014Ras signaling pathway
hsa04015Rap1 signaling pathway
hsa04024cAMP signaling pathway
hsa05163Human cytomegalovirus infection
hsa04020Calcium signaling pathway
hsa05034Alcoholism
hsa05170Human immunodeficiency virus 1 infection
hsa04022cGMP-PKG signaling pathway
hsa05167Kaposi sarcoma-associated herpesvirus infection
hsa04261Adrenergic signaling in cardiomyocytes
hsa05152Tuberculosis
hsa04740Olfactory transduction
hsa04921Oxytocin signaling pathway
hsa04371Apelin signaling pathway
hsa04910Insulin signaling pathway
hsa04218Cellular senescence
hsa04728Dopaminergic synapse
hsa04270Vascular smooth muscle contraction
hsa05418Fluid shear stress and atherosclerosis
hsa04114Oocyte meiosis
hsa04722Neurotrophin signaling pathway
hsa04070Phosphatidylinositol signaling system
hsa04915Estrogen signaling pathway
hsa04922Glucagon signaling pathway
hsa04916Melanogenesis
hsa04713Circadian entrainment
hsa04625C-type lectin receptor signaling pathway
hsa04925Aldosterone synthesis and secretion
hsa04750Inflammatory mediator regulation of TRP channels
hsa04970Salivary secretion
hsa04912GnRH signaling pathway
hsa04971Gastric acid secretion
hsa04720Long-term potentiation
hsa05031Amphetamine addiction
hsa04924Renin secretion
hsa05214Glioma
hsa05133Pertussis
hsa04744Phototransduction
Associated diseases References
Alzheimer's disease PMID:11470324
Aberrant CpGs in Low Motility Sperm MIK: 21674046
Cryptorchidism MIK: 28606200

PubMed references

Expand All | Collapse All

PMID Condition Mutation Ethnicity Population details Infertility_type Associated_genes Abstract
21674046 Aberrant C
pGs in Low
Motility
Sperm

18
Male infertility GSE26881
Show abstract
28606200 Cryptorchi
dism

Monozgotic twin
s (1 control, I
cwith cryptorc
hidism)
Male infertility MeDIP-Seq
Show abstract